KEGG   Camelus dromedarius (Arabian camel): 105101649Help
Entry
105101649         CDS       T04642                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk05164  Influenza A
cdk05202  Transcriptional misregulation in cancer
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    105101649 (TMPRSS2)
   05215 Prostate cancer
    105101649 (TMPRSS2)
  09167 Infectious diseases
   05164 Influenza A
    105101649 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cdk01002]
    105101649 (TMPRSS2)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     105101649 (TMPRSS2)
Peptidases [BR:cdk01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105101649 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 105101649
NCBI-ProteinID: XP_010993167
LinkDB All DBs
Position
Un
AA seq 492 aa AA seqDB search
MALNSGSPPGVGPYYENHGYQPESFYPLKPSAASSAYMVYPAQYYPPAVPQYTPRVQTHT
STPVIRMQPKPPSETVCTSKTKKVLCVTLGLGAILVGAVLAAVLLWKFKESRCSASEMEC
GSSGTCISPSQWCDGVLHCPGGEDENQCVRLYGPNFILQVYSPQRKSWHPVCQEDWSESF
GRAMCQDLGYGNSFYSSQGVVDDSGATSFMKLNISANNIDLYKKLYHSDVCSSKRVVSLR
CIECGVSEKTSRQSRIVGGSSANLGDWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEQ
PLSNAKIWTAFAGILSQSLMIYGNGYQIAKVISHPNYDSKTKNNDIALMKLQTPLTFNDR
VKPVCLPNPGMMLEATQSCWISGWGATYEKGKTSDVLNAVMVHLIEPWKCNSKYVYNNLI
TSAMICAGYLQGGVDSCQGDSGGPLVTLKNSVWWLLGDTSWGSGCAKAYRPGVYGNMTVF
TDWIYRQMRANS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaactcaggatcaccaccaggagtcggaccttactatgaaaaccatgggtac
caacccgaaagcttctatcctctgaagccctctgcggcctccagtgcctacatggtgtat
ccggctcagtattacccgcctgcggtgccccagtataccccaagggttcagacgcacact
tcgacacccgtcatccgcatgcagcccaaacccccgtcggagacagtgtgcacctcaaag
actaagaaagtgctgtgcgtcacccttggcctgggggccatcctagtgggagcagtgctg
gctgccgtcctgctctggaagttcaaggagagcaggtgctcggcgtccgagatggagtgt
ggctcgtcggggacctgcatcagcccctctcagtggtgcgacggcgtcctgcactgcccc
ggcggcgaggacgagaaccagtgtgtgcgcctctacggacccaacttcatccttcaggtc
tactcacctcagaggaagtcctggcaccccgtgtgtcaggaagactggagtgagagcttc
gggagggccatgtgccaggacctgggctacgggaatagtttttattctagccaaggagta
gtggatgacagcggggccacaagctttatgaagctgaacatcagtgccaacaacatcgat
ctctataaaaagctgtaccacagtgatgtctgttcttcaaaaagagtggtttctttgcgc
tgtatagagtgcggggtctccgagaagacgagccgccagagccggatcgtgggcggctcg
agcgccaacctgggggactggccctggcaggtcagcctgcacgtgcagggcatccacgtc
tgcggaggctccatcatcacccccgagtggatcgtgactgccgcccactgcgtggagcag
cctcttagcaatgccaagatttggacagcctttgcaggaattttgagtcaatctctcatg
atctatggaaatggatatcaaatagcaaaagtgatttcccatccaaattatgattccaag
accaagaacaatgacattgctcttatgaagctgcagacacctctgacttttaacgacaga
gtgaagccggtgtgtctgcccaacccgggtatgatgctggaggcgacacagtcctgctgg
atttccgggtggggggccacctacgagaaagggaaaacctcagacgtgctgaacgccgtc
atggtccacctcattgagccctggaaatgcaacagcaaatatgtgtacaacaacctgatc
acatcggccatgatctgtgcggggtacctgcagggaggcgtcgactcctgccagggtgac
agcggaggtcctctggtcactctgaagaacagcgtctggtggctgcttggggacacaagc
tgggggtctggctgtgccaaggcttacagacccggagtgtacggaaacatgacagtgttt
acagactggatttatcgacaaatgcgggccaacagctaa

DBGET integrated database retrieval system