KEGG   Camelus dromedarius (Arabian camel): 105101741Help
Entry
105101741         CDS       T04642                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00052  Galactose metabolism
cdk00500  Starch and sucrose metabolism
cdk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105101741 (GANC)
   00500 Starch and sucrose metabolism
    105101741 (GANC)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105101741 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 105101741
NCBI-ProteinID: XP_010993274
LinkDB All DBs
Position
Un
AA seq 926 aa AA seqDB search
MGATMLFSSGIRARAHQIWMLSKEEKPQSRRTPGSSAQDSMWLRRELRSQASKCQLSKTS
ATQLPRLRTLKTPWNRLHVQVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKPS
TVRLTSCSGDTGSLVLADGKGDLKCHITANPFKVDLVSEEEVVMSINSLGQLYFEHLQNP
LMQRATKENEDTSVDTTQENQDELCLWEEKFENFVDVKVNGPASIGLDFSLHGFEHLYGI
PQHAESHQLKNTGDGDAYRLYNLDVYGYKVHDKMGIYGSVPYLLAHKLGRTLGIFWLNAS
ETLVEISTEPAVKYTLTQMGPVAAKQKVESRTDVRWMSESGIIDVFLLTGPTPSDVFRQY
SYLTGTQAMPPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYF
TWDKKRFPNPKRMQELLRSKKRKLVVISDPHIKVDPNYSVYAKAKEQGFFVRNHDGGDFE
GVCWPGLSSYLDFTNPKVREWYSSLFAFSVYQGSTDILHVWNDMNEPSVFRGPELTMQKN
AIHHGNWEHRELHNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDN
TAEWSYLKISVPMLLTLSITGISFCGADIGGFIGNPEAELLVRWYQAGAYQPFFRSHATK
NTRRREPWLFGEKHTQLIREAIRERYALLPYWYSLFYFAHVASQPVMRPLWIEFPGELET
FGVEDEYMLGSALLVHPVTEPKATVVDVFLPGSNEVWFDSKTFSHWKGACTVKIPVSLDT
IPVFQRGGSVVPIKTTIGKSTGCMTDSPYGLRVALSTKGSAVGEVYLDDGHSFQYLHQKQ
FMHRKFSFSSGVLINSCADERGRYPSKCVVEQIFVLGLKKQPSSVTAHSSDGKAQPVAFT
YCAKTSTLSLEKLSLNIGADWKVHIQ
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaacaatgctgttcagttcaggtatcagagccagagcccatcagatctggatg
ctctcaaaggaagagaagccacaatccaggaggacccctgggagctcagcacaagacagc
atgtggctcagaagggagctgaggagccaagcaagcaagtgccagttatccaagacatca
gcaacacagctcccaagactgagaactttgaagaccccctggaacagactccatgttcag
gttcctctcctagctgaagtttatggtatagagggaaatattttcaggcttaaaatcaat
gaagaaacacccctgaagcccaggtatgaagttcccgatgtcctcacaagcaagccaagc
actgtaaggctgacttcatgctcaggggatacaggcagtctggtattggcagatggaaaa
ggagatctgaagtgtcatataacagcaaacccattcaaggtagacttggtgtctgaagaa
gaggtggtgatgagcataaactccctgggccagttgtactttgagcacctgcagaatcct
ctcatgcaaagagctaccaaggaaaatgaggatacatcagttgacaccactcaggaaaat
caggatgaactgtgcctgtgggaggagaaatttgaaaattttgtggatgtcaaagttaat
ggtcctgcctccattggtttggatttctccttgcatggatttgaacatctctatgggatc
ccacaacatgcagaatcacaccaacttaaaaatactggtgatggggatgcttaccgactt
tataacctagatgtctacggatataaagtacatgacaaaatgggcatttatggttcagtg
ccttatctcctggcccacaaactgggcaggactctaggcattttttggctgaatgcctca
gaaacactagtggagatcagtacagaacctgcagtaaagtacacactgacccaaatgggc
ccagttgccgctaaacagaaggtcgaatctcgaactgatgtgcgctggatgtcagagagt
ggaatcattgatgtttttctgctgacaggacctacaccttctgacgtcttcaggcagtac
tcataccttacaggcacacaggccatgcccccactcttctccttggggtaccatcagtgc
cgctggaactatgaagatgagcaggatgtaaaagcagtggatgcaggatttgatgaacat
gacattccttacgacgtcatgtggctggacatagagcacaccgagggcaaaaggtacttc
acctgggacaagaaaagattcccaaatcccaaaaggatgcaagagctgctcaggagcaaa
aaacgtaagcttgtggtcatcagtgacccccacatcaaggttgatcccaactactcagtg
tatgctaaggccaaagaacagggcttcttcgtgaggaatcatgatgggggtgactttgaa
ggtgtatgctggcctggtctctcctcctacctggatttcaccaatcccaaggtcagagag
tggtattcaagcctttttgccttctctgtttatcaggggtctactgacatcctgcacgtg
tggaatgacatgaatgagccctctgtctttagagggccagagctaaccatgcagaagaat
gccattcatcatggcaactgggagcaccgagaacttcacaatatctatggcttttatcag
caaatggccactgcagaaggactgatccagcgatctaaagggaaggagagacccttcgtt
cttacacgttctttctttgctggatcacaaaagtatggtgctgtgtggacaggtgacaac
acagcagaatggagttacctgaaaatttctgtccctatgttactgacccttagcattact
gggatctctttttgtggagctgacatcggtggcttcatcgggaacccagaggcagagctg
ctagtgcgatggtaccaggccggagcctaccagcccttcttccgcagccatgctaccaag
aacaccaggcgacgggaaccctggctctttggagagaagcacacccagctcatccgcgaa
gccatcagagagcgctatgccctcctgccctattggtattctctgttctactttgcacac
gtggcttcccaacccgtcatgagacctctatggatagagtttcctggtgaattagagact
tttggtgtggaagatgaatacatgttgggaagtgctttattggttcatccagtcacagaa
ccaaaagccactgtggttgatgtgtttctgccaggatcaaatgaggtctggtttgactct
aagacgttttctcattggaaaggagcatgtactgtaaagatcccagtatccctggacact
ataccagtgtttcagcgaggtggaagtgtggtaccaataaagacaactataggaaaatct
acaggctgcatgactgattccccatatggcctccgggtggccctaagcactaagggttct
gccgtgggtgaagtctatctcgatgatggccattcattccagtacctccaccagaagcaa
ttcatgcacagaaagttttcgttctcctcaggtgttttgatcaacagttgtgccgacgag
aggggtcgttatcccagcaagtgtgtagtggagcagatctttgtcctaggcctcaagaag
cagccgtcttctgtgaccgcccactcatctgatggtaaagctcagcccgtggcttttaca
tattgtgccaaaacgtccaccctgagcctggagaagctctcgctgaacattggcgctgac
tggaaggtccacatccagtga

DBGET integrated database retrieval system