KEGG   Camelus dromedarius (Arabian camel): 105101803
Entry
105101803         CDS       T04642                                 

Gene name
RB1
Definition
(RefSeq) LOW QUALITY PROTEIN: retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk04110  Cell cycle
cdk04218  Cellular senescence
cdk04934  Cushing syndrome
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05212  Pancreatic cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105101803 (RB1)
   04218 Cellular senescence
    105101803 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105101803 (RB1)
   05203 Viral carcinogenesis
    105101803 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105101803 (RB1)
   05225 Hepatocellular carcinoma
    105101803 (RB1)
   05226 Gastric cancer
    105101803 (RB1)
   05214 Glioma
    105101803 (RB1)
   05220 Chronic myeloid leukemia
    105101803 (RB1)
   05218 Melanoma
    105101803 (RB1)
   05219 Bladder cancer
    105101803 (RB1)
   05215 Prostate cancer
    105101803 (RB1)
   05224 Breast cancer
    105101803 (RB1)
   05222 Small cell lung cancer
    105101803 (RB1)
   05223 Non-small cell lung cancer
    105101803 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105101803 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105101803 (RB1)
   05161 Hepatitis B
    105101803 (RB1)
   05160 Hepatitis C
    105101803 (RB1)
   05163 Human cytomegalovirus infection
    105101803 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105101803 (RB1)
   05169 Epstein-Barr virus infection
    105101803 (RB1)
   05165 Human papillomavirus infection
    105101803 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105101803 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105101803 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105101803 (RB1)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105101803 (RB1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    105101803 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 105101803
NCBI-ProteinID: XP_031322299
LinkDB
Position
14
AA seq 929 aa
MPPKTPRRAAAATAAAAAARSPAAAAAPPPEADAEQDSGPEDLPLARLEFEETEEPDFTA
LCQKLKVPDHVRERAWLTWEKVSSVDGVLEGYIQKKKELWGICIFIAAVDLDEMPFTFTE
LQKSIETSVYKFFDLLKEIDTSTKVDNVMSRLLKKYNVLCALYSKLERTCELIYLAQPSS
SISTEINSMLVLKVSWITFLLAKGEVLQVEDDLVISFQLMLCVLDYFIKLSPPALLKEPY
KTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPF
MNSLGIVASNGLPEVESLSKQYEEIYLKNKDLDARLFLDHDKTLQADPTDSSEIQRTPQK
SNPDEEVNVILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRV
KNIGHIFKEKFAKAVGQGCIEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLND
DIFHKSLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVLNLKAFDFYKVIESFIKAE
ANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPADHLESPCTLNLPLQNN
HTAADMYLSPVRSPKKKGSTTRVNSTANSEAQATSTFQTQKPLRSTSLSLFYKKVYRLAY
LRLNTLCARLLSDHPELEHIIWTLFQYTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDL
KFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTL
SPIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGLPTPTKMTPRSRILVSIGESF
GTSEKFQKINQMVCNSDRALKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHIPGESKFQQ
KLAEMTSTRTRMQKQKMNDSMDTSHREEK
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagccgctgccaccgccgccgccgccgctgcgcgg
agccccgccgccgccgccgccccgccaccggaggcggacgccgagcaggacagcggcccg
gaggacctgcctctcgccagacttgagtttgaagaaactgaagaacctgattttactgca
ttatgtcagaaattaaaggtaccagatcatgtcagagaaagagcttggttaacttgggag
aaagtttcatctgtggatggagtattggaaggttatattcaaaagaaaaaggaactatgg
ggaatctgtatctttattgcggcagttgacctagatgagatgccattcactttcactgag
ctgcagaaaagcatagaaaccagtgtctataaattctttgacttactaaaagaaattgat
accagtaccaaagttgataatgttatgtcaagactattgaagaagtataatgtactgtgt
gcactctacagcaaattagaaaggacatgtgaacttatatacttggcacaacccagcagt
tcgatatctactgaaataaattctatgttggtgctaaaagtctcttggatcacattttta
ctagctaaaggggaagtattgcaagtggaagatgatctggtgatctcatttcagttaatg
ctctgtgtccttgactattttatcaaactctcacctcctgcattgctcaaagaaccatat
aaaacagctgtaatacctattaatggttcacctcgaacaccaaggcgaggtcagaacagg
agtgcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaa
gaacatgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttatccctttt
atgaattctcttggaattgtagcttctaatggacttccagaggtggaaagtctctctaaa
cagtatgaagaaatttaccttaaaaacaaagatctagatgcaagattatttctggatcat
gataaaactcttcaggctgatcctacagacagttctgaaatacagagaactccacaaaaa
agtaatcctgacgaagaggtgaatgtgattcttccacagactccagttaggactgttatg
aataccatccagcaattaatgatgatcttaaattcagcaagtgatcaaccatcagaaaac
ctgatttcctactttaataattgcacagtgaatccaaaggaaagtatcctgaaaagagtg
aagaatattggacacatctttaaagagaaatttgctaaagctgtggggcagggatgtata
gaaattggatcacagcgatataaacttggagtccgattgtattaccgagtaatggaatcc
atgcttaaatcagaagaagaacgattatccattcagaattttagcaaactgctgaatgac
gacatctttcataagtctttgttggcatgcgctcttgaggttgttatggctacatatagc
agaagtacgtctcagaatctcgatactggaacagatttgtcctttccatggattttgaat
gtactcaatttaaaagcttttgatttttacaaagtgattgaaagttttatcaaagcagaa
gccaacttgaccagagaaatgattaaacatttagaacgatgtgaacatcgaatcatggaa
tcccttgcatggctctcagattcacctttatttgatcttattaaacaagcaaaggaccga
gagggaccagctgatcaccttgagtctccttgtactctcaaccttcctctacagaataat
cacactgcagcagacatgtatctttctcctgtaagatccccaaagaaaaaagggtcaact
acacgtgtaaattctacggcaaattcagaggctcaagcaacctcaaccttccagactcag
aagccattgagatctacctccctctcactcttttacaaaaaagtgtaccgactagcgtat
cttcgactaaataccctgtgtgcacgccttctgtctgaccatccagaactagaacacatc
atctggacccttttccagtacacactgcaaaacgagtacgaactcatgagagacaggcat
ttggaccagattatgatgtgttccatgtatggcatatgcaaggtgaagaatatagacctt
aagttcaaaatcattgtaacagcatacaaagatcttcctcatgctgttcaggagacattc
aagcgtgttttgatcagagaagaggagtatgattccattatcgtgttctataattcagtc
ttcatgcagagactgaaaacaaacattttgcagtatgcttccaccaggccacctaccttg
tcaccaattcctcacattcctcgaagcccttacaagttttctagttcacctttaaggatc
cctggggggaacatctatatatcacccctaaagaatccatataaaatttcagaaggtctg
ccaacgccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcattt
gggacttctgagaagttccagaaaataaatcaaatggtgtgtaacagcgaccgtgcgctc
aaaagaagtgctgaaggaagcaaccctcctaaaccgctgaaaaaactgcgctttgacatt
gaaggatcagatgaagcagatggaagtaaacatatcccaggggagtccaaatttcaacag
aaactggcagaaatgacatctactcgaacacgaatgcaaaagcagaaaatgaatgatagc
atggatacctcacacagggaagaaaagtga

DBGET integrated database retrieval system