Camelus dromedarius (Arabian camel): 105102039 Help Entry 105102039         CDS       T04642                                  Symbol RAP1A Name (RefSeq) ras-related protein Rap-1A   KO K04353   Ras-related protein Rap-1A Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04010   MAPK signaling pathway cdk04014   Ras signaling pathway cdk04015   Rap1 signaling pathway cdk04024   cAMP signaling pathway cdk04062   Chemokine signaling pathway cdk04510   Focal adhesion cdk04520   Adherens junction cdk04530   Tight junction cdk04611   Platelet activation cdk04670   Leukocyte transendothelial migration cdk04720   Long-term potentiation cdk04722   Neurotrophin signaling pathway cdk04934   Cushing syndrome cdk04972   Pancreatic secretion cdk05211   Renal cell carcinoma cdk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105102039 (RAP1A)    04014 Ras signaling pathway     105102039 (RAP1A)    04015 Rap1 signaling pathway     105102039 (RAP1A)    04024 cAMP signaling pathway     105102039 (RAP1A)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     105102039 (RAP1A)    04520 Adherens junction     105102039 (RAP1A)    04530 Tight junction     105102039 (RAP1A)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     105102039 (RAP1A)    04670 Leukocyte transendothelial migration     105102039 (RAP1A)    04062 Chemokine signaling pathway     105102039 (RAP1A)   09154 Digestive system    04972 Pancreatic secretion     105102039 (RAP1A)   09156 Nervous system    04720 Long-term potentiation     105102039 (RAP1A)    04722 Neurotrophin signaling pathway     105102039 (RAP1A)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     105102039 (RAP1A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105102039 (RAP1A)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     105102039 (RAP1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:cdk04031]     105102039 (RAP1A) GTP-binding proteins [BR:cdk04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     105102039 (RAP1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase G-alpha MMR_HSR1 AAA_16 Motif Other DBs NCBI-GeneID:  105102039 NCBI-ProteinID:  XP_031313372 LinkDB All DBs Position 9:16385012..16455283 Genome browser AA seq 190 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKIVQFIVTLVPDCQQCMLE ILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILV GNKCDLEDERVVGKEQGQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKK KPKKKSCLLL NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtacaagctagtggtccttggttcaggaggcgtggggaagtctgctctgaca gttcaatttgttcagggaatttttgttgaaaaatatgacccaacgatagaagattcctac agaaagattgtgcagttcattgtcacgttagtccctgactgccaacagtgtatgctcgaa atcctggatacagcgggaacagagcaatttacagcaatgagggacttgtatatgaagaat ggccaagggtttgcattagtatattctattacagctcagtccacatttaatgacttacag gacctgagggaacagattttacgggttaaggacacagaagatgttccaatgattttggtt ggcaataaatgtgacctggaagatgagcgagtagttggcaaagaacagggtcagaattta gcaagacagtggtgtaactgtgcctttttagaatcttctgcaaagtcaaagatcaacgtt aatgagatattttatgacctggtcagacagataaataggaaaacaccagtggaaaagaag aagcctaaaaagaaatcatgtctgctgctttag

DBGET integrated database retrieval system