KEGG   Camelus dromedarius (Arabian camel): 105102071Help
Entry
105102071         CDS       T04642                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00250  Alanine, aspartate and glutamate metabolism
cdk00410  beta-Alanine metabolism
cdk00430  Taurine and hypotaurine metabolism
cdk00650  Butanoate metabolism
cdk01100  Metabolic pathways
cdk04727  GABAergic synapse
cdk04940  Type I diabetes mellitus
Module
cdk_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105102071 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105102071 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105102071 (GAD2)
   00430 Taurine and hypotaurine metabolism
    105102071 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    105102071 (GAD2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    105102071 (GAD2)
Enzymes [BR:cdk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105102071 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 105102071
NCBI-ProteinID: XP_010993636
LinkDB All DBs
Position
Un
AA seq 585 aa AA seqDB search
MASPGSGFWSFRSEDGSGDPENSGTARAWCQVAQKFTGGIGNKLCALLYGEAEKPEESGG
SQPPRATSRKAACACNQKPCSCPKADVNYAFLHATDLLPACDGERPTLAFLQDVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYVPLSLRVLDDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcccggctccggcttctggtccttcagatctgaagatggctccggggatccc
gagaactccggcacagcgagagcctggtgtcaggtggcccagaagttcacgggcggcatc
ggaaacaagctgtgcgccctgctctacggagaggcggagaagccagaggagagcggtggg
agccagcccccgcgggccacctcccggaaggccgcctgcgcctgcaaccagaagccctgc
agctgccccaaagcggatgtcaactatgcgtttctacacgcaacagacctgctaccagcg
tgtgatggagaaaggcccactttggcgtttctgcaagatgttatggacattttgcttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
cttcttcaagaatataattgggagttggcagaccaaccacagaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatcccaggtatttcaat
caactttctactggactggatatggttggattagcagcagactggctgacatcaacagca
aacacgaacatgttcacctatgaaattgctcctgtctttgtgcttttggaatatgtcacg
ctaaagaagatgagagaaatcattggctggccagggggctctggcgatgggatattttct
cctggtggcgccatatctaacatgtacgccatgctcatcgcgcgctttaagatgttcccg
gaagtcaaggagaaaggaatggcggctgtccccaggctcatcgccttcacatctgagcat
agtcatttttccctcaagaagggagctgcagccttgggcattggaacagacagcgtgatt
ctgattaaatgtgatgaaagggggaaaatgattccatccgatcttgaaagaaggatcctt
gaagtcaaacaaaaagggtttgtccctttccttgtgagtgccacggctgggaccaccgtg
tatggagccttcgatcccctcttagctgttgccgacatctgcaaaaagtacaagatctgg
atgcacgtggatgcagcttggggtgggggattactgatgtcccggaagcacaagtggaag
ctgaacggcgtggagagggccaactctgtgacgtggaatccgcataagatgatgggcgtc
cctctgcagtgctctgctctcctggtcagagaagagggactgatgcaaagttgcaaccag
atgcatgcctcctacctctttcagcaagataaacactacgacctgtcctacgacaccgga
gacaaggccttacagtgtggacgccacgtcgatgtttttaagctctggctcatgtggagg
gcaaaggggacaactgggtttgaagcacacattgataagtgtttggagctggcagagtat
ttatacaacatcatcaaaaaccgagaaggatatgaaatggtgtttgatggaaagcctcag
cacacaaacgtctgcttctggtatgtgcctctgagtctgcgggtcctggacgacaacgaa
gagagaatgagccgcctctccaaggtggctccagtgattaaagccagaatgatggagtac
gggaccacaatggtgagctaccagcccttgggagacaaggtcaatttcttccgcatggtc
atctcaaaccctgcagccactcaccaagacattgacttcctgattgaagaaatagaacgc
cttgggcaagatttataa

DBGET integrated database retrieval system