KEGG   Camelus dromedarius (Arabian camel): 105102182Help
Entry
105102182         CDS       T04642                                 

Gene name
BRD9
Definition
(RefSeq) bromodomain-containing protein 9 isoform X1
  KO
K22184  bromodomain-containing protein 9
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105102182 (BRD9)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    105102182 (BRD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3512 Bromodomain TFIIF_alpha NPR3 SR-25
Motif
Other DBs
NCBI-GeneID: 105102182
NCBI-ProteinID: XP_031298236
LinkDB All DBs
Position
3
AA seq 634 aa AA seqDB search
MGKKHKKHKTEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHREKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREKEHCDTEGEADDFGPGRKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKE
RLLALKRSVSFMQDMDFSQQAALLGSEDTAVEEPVPEVVPVQVETAKKSKRPSREVISCV
FEPEGNACSLTDSTAEEHVLALVEHAADEARDRINRLVPGGKMGYLRKSGDGSLLYSVVN
TAEPDADEEETHPVDLSSLSSKLVPGITTLGFREERRSRVTFLSSASTALSLHNNSVFGD
LKSDEAELLYSAYGDETGVQCALSLQEFVKGAGSYSRKMVDDLLDQITGGDHSRMLSQLR
QRRNVPMKPPDEGKAGDPLGDGGSALDFMAVKSYPDVSLDISVLGCLGKVKKELDPDDGH
LNLDETAKLLQDLHEAQVERGGSRPSSNLSSLSNASDRDQHHLGEGHREGPGKPGLLWVP
SASPQAGPWPLVTADHHGCPEEALLASVSGSSQR
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaagcacaagaagcacaagaccgaatggcgctcgtcgtacgaggattacgca
gacaagcccctggagaagcccctgaagctggtcctcaaagtcggaggaagcgaagtgacg
gaactctcggggtcaggccacgactccagttactacgatgacaggtcggaccatgagcgg
gagagacacagagagaagaagaagaagaagaagaagaagtctgagaaggagaagcacctt
gacgacgaagaaaggaggaagcgaaaggaggagaagaagcggaaacgggagaaggagcac
tgtgacacggagggggaggcggatgatttcggtcctgggaggaaggtggaggtggaaccg
ccccccgatcggccagtccgcgcctgccggacgcagccagctgaaaacgagagcacgcct
attcagcagctgctcgagcatttcctgcgccagctccagaggaaagatcctcatgggttt
tttgcttttcctgtcacggatgccattgctcctggatactcgatgataataaaacatccg
atggatttcggcacaatgaaagacaaaattgtagctaatgagtacaagtcagtcacggaa
tttaaggccgatttcaagctgatgtgtgacaacgccatgacgtacaacagaccagacacc
gtgtactacaagctagccaagaagatcctccacgccggctttaagatgatgagcaaagag
cggctgttagctctgaagcgcagcgtgtcgtttatgcaggacatggatttctctcagcag
gcagctcttctgggcagcgaagacacagccgtcgaggagcctgttcccgaagtcgtgcct
gtgcaagtagaaactgccaagaaatctaagaggccgagcagagaagtcatcagctgcgtg
tttgagccggaaggaaatgcttgcagcctgaccgacagcaccgcagaggagcacgtgctg
gccttggtggagcacgcggccgacgaggcccgggacaggatcaaccggctcgtccccggg
ggcaagatgggctacctgaggaagagcggggacgggagcctgctgtacagcgttgtcaac
acagccgagccggatgctgacgaggaggagacccacccagtggacctgagctcactgtcc
agcaagctggtcccaggcatcaccaccctgggcttccgggaggagcggaggagcagagtc
acgtttctgtccagcgccagcactgcactctccctacacaacaactcggtgttcggggac
ctgaagtccgacgaggcggagctgctgtactcagcctacggggacgagacgggtgtgcag
tgcgcactcagcctgcaggagtttgtgaagggcgcagggagctacagcaggaagatggtg
gacgacctcctggaccagatcacgggcggagaccactctcggatgctgtcccagctgcgg
cagaggagaaacgtcccgatgaagcctcctgacgaagggaaggctggagaccctctaggg
gacggtggctccgccctggacttcatggccgtgaagtcgtatccggatgtctctctggac
atctccgtgctcggctgtctggggaaggtgaagaaggagctggaccctgatgacggccac
ctgaacctggacgagacggcaaagctcctgcaggacctgcacgaggcacaggtggagcgc
gggggctcccggccgtcgtccaacctcagctccctgtccaacgcctccgacagggaccag
caccacctgggtgaggggcaccgggagggtcctggaaagccggggctcttgtgggtgccc
agtgcaagtccgcaggcagggccctggcccctggtcacagcagatcaccacggctgcccc
gaggaagcccttctcgcctcagtgtcggggagcagccagaggtga

DBGET integrated database retrieval system