KEGG   Camelus dromedarius (Arabian camel): 105102189Help
Entry
105102189         CDS       T04642                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00020  Citrate cycle (TCA cycle)
cdk00190  Oxidative phosphorylation
cdk01100  Metabolic pathways
cdk01200  Carbon metabolism
cdk04714  Thermogenesis
cdk04932  Non-alcoholic fatty liver disease (NAFLD)
cdk05010  Alzheimer disease
cdk05012  Parkinson disease
cdk05016  Huntington disease
Module
cdk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cdk_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105102189 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105102189 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    105102189 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    105102189 (SDHA)
   05012 Parkinson disease
    105102189 (SDHA)
   05016 Huntington disease
    105102189 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105102189 (SDHA)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105102189 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 105102189
NCBI-ProteinID: XP_010993759
LinkDB All DBs
Position
Un
AA seq 665 aa AA seqDB search
MSGVRAVSRLLRARRLALSSGQQPAALQTGARSFHFTIDGTKRSSAKVSDAISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVTALCI
EDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLKHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
RVPSIKPNAGEESVMNLDKLRFANGSIRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKI
SQLYRDLQHLRTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKE
RVDEYDYSKPIQGQQQKPFEQHWRKHTLSYVDIKTGKVSLEYRPVIDRTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgtccgggcggtgtcgcggctgctgcgcgcccggcgcttggcgctgagctcc
gggcagcagccagcagcattgcagacaggagcccgcagtttccacttcaccattgatggc
actaagaggtcgtctgccaaagtttcagatgcaatttctacccagtacccagtagtggat
catgaatttgatgcagtggtggtcggcgctggaggggcaggcctacgagctgcatttggt
ctttctgaggcagggtttaacacggcctgtgttacgaagctctttcctaccaggtcacac
actgtcgcagcccaggggggcatcaacgctgcactggggaacatggaggaggacaactgg
aggtggcacttctatgacactgtgaagggctccgactggctgggggaccaggatgccatc
cactacatgacggagcaggcccccgcctccgtggtggagctggagaactatggcatgccg
ttcagcagaaccgaggatgggagaatctaccagcgcgcctttggaggacagagcctgaag
ttcgggaaaggcgggcaggcccatcggtgctgctgtgtggctgaccgcactggccactca
ctgctgcacacgttgtatggaaggtctctgcgatatgataccagctattttgtggagtat
tttgccttggatctcctgatggaagatggggagtgtcgtggagttactgccctgtgcata
gaggatgggtccatccaccgcatcagagcaaagaacactgttgtggccacgggaggctac
gggcgcacctacttcagctgcacgtctgcccacaccagcaccggggatggcactgccatg
atcaccagggcaggccttccctgccaggacctggagttcgttcagttccaccccacaggc
atatacggtgctggctgtctcatcacggaagggtgtcgcggagagggcggcatcctcatt
aacagtcaaggcgaaaggttcatggagcggtacgcccctgtcgcaaaggacctggcatcc
agggacgttgtgtcccggtccatgactctggaaatccgtgaaggaagaggctgtggcccc
gagaaggaccacgtctacctgcagctgcatcacctgcccccagagcagctggcgatgcgc
ctgccaggcatctcagagacggccatgatcttcgcaggcgtggatgtcaccaaggagcca
atccccgtgctccccactgtgcactataacatgggcggcatccccacgaactacaagggg
caggttctgaagcatgtgaacggccaagatcagatcgtgccaggcctgtacgcgtgtggg
gaggccgcctgcgcctctgtgcatggcgccaaccgtctgggggccaactcactcctagac
ctggtggtctttggccgagcgtgcgccctgagcatcgcagagtcctgcagacccggagat
agggttccctcgattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaattg
agatttgctaatggaagcataagaacatcggaactgcgactcaacatgcagaagtcgatg
cagagccacgctgcagtgttccgtgtggggagcgtgctgcaggagggctgtgagaagatc
agccagctctaccgcgacctgcagcacctgaggacgtttgaccggggaatggtttggaac
actgacctggtggagaccctggagctgcagaacctgatgctctgtgccctgcagaccatt
tacggagcagaggcccggaaggagtcacggggcgctcatgccagggaggatttcaaggag
cgggttgatgagtatgattactccaagcccatccaggggcagcagcagaagccgtttgag
cagcactggaggaagcacacgctttcctacgttgacatcaagacagggaaggtctcgctg
gaatacagacctgtcatcgacagaacgttgaacgaggctgactgcgccactgttccccca
gccatccgctcctactga

DBGET integrated database retrieval system