KEGG   Camelus dromedarius (Arabian camel): 105102193
Entry
105102193         CDS       T04642                                 

Gene name
TERT
Definition
(RefSeq) telomerase reverse transcriptase isoform X1
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05200  Pathways in cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105102193 (TERT)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105102193 (TERT)
   05226 Gastric cancer
    105102193 (TERT)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105102193 (TERT)
   05165 Human papillomavirus infection
    105102193 (TERT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cdk03032]
    105102193 (TERT)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     105102193 (TERT)
DNA replication proteins [BR:cdk03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    105102193 (TERT)
   Telomerase complex (fungi)
    105102193 (TERT)
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 105102193
NCBI-ProteinID: XP_031298479
LinkDB
Position
3
AA seq 1146 aa
MPRALQCRAVRSLLRSRYRQVLPLATFVRRLGPEGRRLVRRGDPAAFRALVAQCLVCVPW
DAQPPPAAPSFRQVSSLKELVARVVQRLCERGARNVLAFGFALLDGARGGPPVAFTTSVR
SYLPNTVTDTLRGSGAWGLLLRRVGDDVLTHLLARCALYLLVAPSCAYQLCGPPLYDLCS
GAAARPGPAGGPQAGLGPTRQARNDGNAGGPWGLPAPGVKRRWGSAEGRPPPAKRPRRAS
RPERGPNGQASGAHLGRATGPSDSDPHAVTETRAAAEAESQEDEVPRTRCPLPLAGGDCG
AGLASWQQSHPQGVPGPRVCVETKHFLYCPGSEERLRRSFLLCSLPPSLAGARKLLETIF
LSSKPWRPGAPGRTRRLPARYWQMRPLFRELLENHARCPYQALLRAHCPLRTEATWAGSG
IPERNGVDTCTLERPTAAPEGHTGPRCLVQLLRQHSSPWQVYALLRACLHRLVPAGLWGS
RHNQRRFMRNVKKLVSLGKHAKLSLQELTWKMKVQDCTWLRRSPGAGCVPAEEHRLREAV
LAKFLCWLMGTYVVELLRAFFYVTETTFQKNRLFFFRKSVWTQLQSIGIRQHLDRVRLRE
LSEAEVKRHQEARHALLTSRLRFLPKPSGLRPIVNMDYVAGARTAPRDKKVQHLSSRVKT
LFAVLNYERTRRPGLLGASVLGVDDVYRAWRAFVLPLRARHPAPPLYFVKVDVTGAYDAL
PQDRLVEVIAKVIRPQESTYCVRRYAVVQRATRGHVRKSFKRHQVSTLADLQPYMRQFVE
HLQATSSLRDAVVIEQSYCLNETGCSLFESFLRLVHNHVMRIGGRSYVQCQGVPQGSVLS
TLLCSLCYGDMEDKVFPGVQQDGVLLRLVDDFLLVTPHLTRAKAFLSTLVRGVPEYGCLA
NLRKTVVNFPVEDGALGGQAPLQLPAHCLFPWCGLLLDTQTLEVRSDYSSYARTSIRASL
TFNQGFKAGRNMRRKLFAVLRLKCHGLFLDLQVNSLQTVFTNVYKIFLLQAYRFHACVLQ
LPFNQPVRRNPAFFLRVVSDTASRAYSLLKARNSGTSLGAQGASGPFPLEAAQWLCLHAF
RLKLAGHHITYSCLLGPLRAARSPRAPFHPMPYPGGGQLHCEVGVSLETLGEVRPPSPQE
SRACAP
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgccgcgcgcgctgcagtgccgggcggtgcgctccctgctgcggagccgctaccggcag
gtgctgccgctggccaccttcgtgcggcgcctggggcccgagggccggcggctggtgcgg
cgcggggacccggcggccttccgcgcgctggtggcccagtgcttggtgtgcgtgccctgg
gacgcacagccgccccccgccgccccgtccttccgccaggtgtccagcctgaaggagctg
gtggcccgggtcgtgcagaggctctgtgagcgcggcgcgaggaacgtgctggctttcggc
ttcgcgctgctggacggggcccgcggcgggccgcccgtggccttcacgaccagcgtgcgc
agctacctgcccaacacggtgaccgacacgctgcgcggcagcggcgcgtgggggctgctg
ctgcgccgcgtgggcgacgacgtgctcacccacctgctggcgcgctgcgcgctctacttg
ctggtggccccgagctgcgcctaccagctgtgcgggccgccgctctatgacctctgcagc
ggcgccgcggctcggcccggacccgcgggcggcccccaggcaggcctcggacctacgcgc
caagcccggaacgacgggaacgctgggggaccctgggggctgcccgccccgggcgtgaag
cggcgttggggcagcgcagagggtcgtccgcctccagccaagaggcccaggcgcgcttcg
aggccagagcgaggacccaatgggcaggcgtccggggcccacctgggcagggctactgga
cctagcgacagcgacccccacgcggtaacagagaccagagctgccgcggaagccgagtct
caggaggatgaggtgccccggacccgttgccccctcccgctggcgggtggcgattgcggt
gcaggcttggcatcctggcagcagtcacatccccagggcgtgcccggtccccgagtgtgc
gtggagaccaagcacttcctgtactgcccggggagcgaggaacggctgcgccgctcgttc
ctgctctgctccctgcctcccagcttggcgggggcccggaagctcctggagaccatcttt
ctgagctcgaagccctggcggccaggggctcccggcaggacgcgccgcctgcccgcccgc
tactggcagatgaggcccctgttccgggagctgcttgagaaccatgcgcgatgtccctac
caagcactgctcagggcgcactgcccgctgcggaccgaggccacctgggcagggtcaggc
atcccggagcgcaatggggtggacacctgcaccctggagaggcccacggcagccccggag
gggcacaccggcccgcggtgcctggtccagctgctccgccagcacagcagcccctggcag
gtgtacgcgctcctgcgagcctgtcttcacaggctggtgcctgctggcctctggggctcc
aggcacaaccagcgccgctttatgaggaacgttaagaagctagtctccctgggaaagcac
gccaagctgtcgctgcaggagctgacgtggaagatgaaagtgcaggactgcacctggctg
cgcaggagcccaggagctggctgcgtcccggctgaggagcaccgtctgagagaggccgtc
ctggccaagttcctgtgctggttgatgggcacatatgtggtcgagctgctcagggcgttc
ttttatgtcacggagaccacgtttcagaagaaccggctcttcttcttccggaagagcgtc
tggacccagctgcaaagcatcggcatcagacaacacttagatcgcgtgcggcttcgagaa
ctgtcggaagccgaggtcaagcgacaccaggaggccaggcacgctctgctgacatccaga
ctccgcttcctccccaagcccagcgggctgcggccaattgtgaacatggactacgtcgcg
ggagccaggaccgccccccgggacaagaaggtccagcacctctcctcccgggtcaagacc
ctgtttgctgttctgaactatgagcggacgcggcgcccgggcctcctgggggcctccgtg
ctgggcgtggacgacgtctacagggcctggcgagccttcgtgctgcccctgagggcccgg
cacccagcaccccctctgtacttcgtcaaggtggacgtgacgggggcgtacgacgccctc
cctcaggacaggctggtggaggtgatcgccaaagtgatccggccccaggagagcacgtac
tgcgtgcgccgatatgctgtggtccagagggccacccgcggacacgtccggaagtccttc
aagagacaccaggtttccacccttgcggacctccagccgtacatgagacagtttgtggag
catctgcaggccaccagctcgctgagggacgccgtggtcatcgagcagagctactgtctg
aatgagaccggctgcagcctcttcgagtccttcctgcgcctggtgcacaaccatgtcatg
aggattgggggcaggtcctacgtccagtgtcagggggtcccccagggctccgtgctgtcc
accctgctctgcagcctgtgctatggagacatggaggacaaggtcttccccggagtgcag
caggatggggtcctcctgcgcttggtggacgacttcctgctggtcacaccccacctgacg
cgtgcgaaggcttttctcagcaccctggtcagaggcgtgcccgagtacggctgcctggcg
aacctgcgcaagacggtggtgaacttccccgtggaagacggcgccctgggcggccaggcc
cccctccagctgccggcacactgcctgttcccctggtgcggcttgctgctggacacccag
accctggaggtgcgcagtgactactccagttacgcccggacctcgatcagagcgagtctc
accttcaaccagggcttcaaggctggaaggaacatgcgccgcaaactcttcgcggtcttg
cggctgaagtgccacggcctctttctggacctgcaggtgaacagtctccagacagttttc
acaaacgtttacaagatattcctgctgcaggcatacaggttccacgcgtgcgtgctgcag
ctgccctttaatcagccggttaggcggaatcccgcgttcttcctccgggtggtctccgac
accgcatcccgcgcctactccctcttgaaagccaggaactcagggacatcactgggggcc
cagggcgcctcaggcccgtttcctttggaagctgcacagtggctctgcctgcatgccttc
cggctcaagctggctggtcaccacatcacctacagctgcctgctggggccgctccgggca
gcccgaagccccagagccccgttccacccgatgccatatcctggagggggccagctgcac
tgcgaggtaggggtctccctggagaccctgggggaggttcggcccccaagtcctcaggaa
agcagggcctgcgcaccatga

DBGET integrated database retrieval system