KEGG   Camelus dromedarius (Arabian camel): 105102385
Entry
105102385         CDS       T04642                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 4V2
  KO
K07427  docosahexaenoic acid omega-hydroxylase [EC:1.14.14.79]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105102385
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.79  docosahexaenoic acid omega-hydroxylase
     105102385
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP4 family
   105102385
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105102385
NCBI-ProteinID: XP_031296121
LinkDB
Position
26
AA seq 524 aa
MLGAVDAGFGQKLLLWGACGVRLLAGVTLTLNLLQMVTSYAWKWQQLRALPTLEGLPLLG
HRADGKADARDFFQQIIECTEEYRNLPLLTLWLGPVPLVAIYNAENVEVILTSSKHIDKS
SMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFAILEDFLDVMNEQANILVNKLEKHV
NQEAFNCFFYITLCALDIICETAMGKNIGAQSNGDSEYVRAVYRMSDSIHQRMKTPWLWL
DFLFCMFKEGREQKRSLKILHNFTNSVITERANEMKRDEEGKWDDKDFPTRKNKCRAFLD
LLLNVTDDEGNKLSHEEIREEVDTFMFEGHDTTAAAVNWSLYLLGSYPEVQKKVDNELEE
IFGKSDRPATLEDLKKLKYLECVIKESLRLFPPVPFFARNLNEDCDVGGYKIVKGSQVII
VPYALHRDPRYFPDPEEFVPERFLPENSKGRHSYAYVPFSAGPRNCIGQKFAIMEEKTIL
SCILRHFWVESNQKREELGLAGELILRPSNGIWVKLKRRNTDES
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgctgggcgctgtggatgctggcttcgggcagaagctgctgctctggggcgcttgtggc
gtccgtctcctggcgggcgtcaccctcaccctgaacctcctgcagatggtgacgagctac
gcgtggaagtggcagcagctgcgtgccctcccgactttggagggcctacccttgctggga
caccgcgctgatggtaaagccgacgcaagagatttttttcagcaaataattgagtgcact
gaagaataccgaaacctgccactcctgacgctctggcttgggcctgtacctctggtggcc
atttataatgcagagaatgtggaggtaattttaactagttcaaagcacatcgacaaatcc
tctatgtacaaattcctagaaccgtggcttggcctaggacttcttacaagtactggaaac
aagtggcgctctaggagaaagatgttaacacctactttccattttgcaattctggaagat
ttcttagatgtcatgaatgaacaagcaaatattttggttaataaacttgaaaaacacgtt
aaccaagaagcatttaactgctttttttacatcactctttgtgccttagatataatctgt
gaaacagccatggggaagaatattggtgctcaaagtaacggtgattccgagtatgttcga
gcagtttataggatgagtgactcgatacatcagagaatgaagacaccctggctctggctt
gactttttgttctgtatgtttaaagaagggcgggagcaaaaaaggagcctaaagatccta
cataattttaccaacagtgtcatcaccgaacgggccaacgaaatgaagagagatgaagag
ggtaaatgggatgacaaggactttccgacgcgcaaaaataaatgcagggcttttcttgac
ttgcttttaaatgtgacggacgatgaaggaaacaagctaagtcatgaagaaattcgagaa
gaagttgacacctttatgtttgagggccacgacacaaccgcagctgcagtaaactggtcc
ttatatctactgggttcttatccagaagtccagaaaaaagtggacaatgaactggaggaa
atatttgggaagtctgatcgtcctgctaccttggaagacctgaagaaacttaaatacttg
gaatgtgttattaaggagagccttcgccttttccctcctgttcccttctttgcccgtaat
ctgaatgaagactgtgacgttgggggttacaaaattgtgaaaggctctcaagtaatcatc
gtgccctacgcactgcacagagatccaagatacttccctgatcctgaggaattcgtgcca
gaacggttcttgcccgagaactcgaaaggacgccattcatacgcatacgtgcccttctct
gctggaccccgcaactgtataggtcaaaagtttgccatcatggaagaaaagaccattctt
tcttgcattctgaggcatttttgggtagaatccaaccaaaagagagaagaacttggtctg
gcaggagagctgattcttcgtccaagtaatggaatctgggtcaagttgaagaggaggaac
acagatgaatcctaa

DBGET integrated database retrieval system