Camelus dromedarius (Arabian camel): 105102679 Help Entry 105102679         CDS       T04642                                  Name (RefSeq) metallothionein-1D   KO K14739   metallothionein 1/2 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04978   Mineral absorption Brite KEGG Orthology (KO) [BR:cdk00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105102679  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cdk03019]     105102679    03029 Mitochondrial biogenesis [BR:cdk03029]     105102679 Messenger RNA biogenesis [BR:cdk03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105102679 Mitochondrial biogenesis [BR:cdk03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105102679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105102679 NCBI-ProteinID:  XP_010994394 LinkDB All DBs Position 9:complement(45540908..45542822) Genome browser AA seq 61 aa AA seqDB search MDPNCSCSTGGSCTCAASCTCKDCRCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgctccactggtggctcctgcacctgcgccgcctcctgcaca tgcaaagactgcagatgcacctcctgcaagaagagctgctgctcctgctgcccggtgggc tgtgccaagtgcgcccagggctgcatctgcaaaggggcgtctgacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system