KEGG   Camelus dromedarius (Arabian camel): 105103011
Entry
105103011         CDS       T04642                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04010  MAPK signaling pathway
cdk04071  Sphingolipid signaling pathway
cdk04110  Cell cycle
cdk04115  p53 signaling pathway
cdk04137  Mitophagy - animal
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04216  Ferroptosis
cdk04218  Cellular senescence
cdk04310  Wnt signaling pathway
cdk04722  Neurotrophin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk05012  Parkinson disease
cdk05014  Amyotrophic lateral sclerosis
cdk05016  Huntington disease
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05217  Basal cell carcinoma
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105103011 (TP53)
   04310 Wnt signaling pathway
    105103011 (TP53)
   04071 Sphingolipid signaling pathway
    105103011 (TP53)
   04151 PI3K-Akt signaling pathway
    105103011 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    105103011 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    105103011 (TP53)
   04210 Apoptosis
    105103011 (TP53)
   04216 Ferroptosis
    105103011 (TP53)
   04115 p53 signaling pathway
    105103011 (TP53)
   04218 Cellular senescence
    105103011 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    105103011 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105103011 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    105103011 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105103011 (TP53)
   05202 Transcriptional misregulation in cancer
    105103011 (TP53)
   05206 MicroRNAs in cancer
    105103011 (TP53)
   05205 Proteoglycans in cancer
    105103011 (TP53)
   05203 Viral carcinogenesis
    105103011 (TP53)
   05230 Central carbon metabolism in cancer
    105103011 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105103011 (TP53)
   05212 Pancreatic cancer
    105103011 (TP53)
   05225 Hepatocellular carcinoma
    105103011 (TP53)
   05226 Gastric cancer
    105103011 (TP53)
   05214 Glioma
    105103011 (TP53)
   05216 Thyroid cancer
    105103011 (TP53)
   05220 Chronic myeloid leukemia
    105103011 (TP53)
   05217 Basal cell carcinoma
    105103011 (TP53)
   05218 Melanoma
    105103011 (TP53)
   05219 Bladder cancer
    105103011 (TP53)
   05215 Prostate cancer
    105103011 (TP53)
   05213 Endometrial cancer
    105103011 (TP53)
   05224 Breast cancer
    105103011 (TP53)
   05222 Small cell lung cancer
    105103011 (TP53)
   05223 Non-small cell lung cancer
    105103011 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    105103011 (TP53)
   05014 Amyotrophic lateral sclerosis
    105103011 (TP53)
   05016 Huntington disease
    105103011 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105103011 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105103011 (TP53)
   05161 Hepatitis B
    105103011 (TP53)
   05160 Hepatitis C
    105103011 (TP53)
   05162 Measles
    105103011 (TP53)
   05168 Herpes simplex virus 1 infection
    105103011 (TP53)
   05163 Human cytomegalovirus infection
    105103011 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105103011 (TP53)
   05169 Epstein-Barr virus infection
    105103011 (TP53)
   05165 Human papillomavirus infection
    105103011 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105103011 (TP53)
   01522 Endocrine resistance
    105103011 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105103011 (TP53)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105103011 (TP53)
   03400 DNA repair and recombination proteins [BR:cdk03400]
    105103011 (TP53)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    105103011 (TP53)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     105103011 (TP53)
DNA repair and recombination proteins [BR:cdk03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    105103011 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 105103011
NCBI-ProteinID: XP_010994816
UniProt: A0A5N4D2L6
LinkDB
Position
16
AA seq 381 aa
MEESQSELGVEPPLSQETFSDLWKLLPENNLLSSELSPAVDELLLSPEVTNWLDENPDEA
PRMQEPPVPAAPAPATSWPLSSFVPSQKTYPGSYGFRLGFLHSGTAKSVTCTYSPPLNKL
FCQLAKTCPVQLWVSSLPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERSSDYSDGLAPPQ
HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRRPIL
TIITLEDASGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQPCPELPPGSTKRALPTSS
SSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGENKAHSSHLKSK
KGQSPSRHKKLMFKREGPDSD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggaggagtcgcaatcagaactcggcgtggagccccctctgagtcaggagacgttttca
gacttgtggaaactgctacctgaaaacaaccttctgtcctctgagctctccccagcagtg
gatgaactactcctgtccccagaagttaccaactggttggatgagaatccagatgaagcc
ccaagaatgcaagagcctcctgtccccgctgcccccgcaccagccacctcctggcccctg
tcatcctttgtcccttcgcagaagacctaccctggcagctacggtttccgtcttgggttc
ctgcattctgggacagccaagtctgtaacctgcacgtactcccctcccctcaacaagctg
ttttgccagctggccaagacctgcccggtgcagctgtgggtcagctccctgcccccgccc
ggcacccgggtccgcgccatggccatctacaagaagtcagagtacatgacggaggttgtg
agacgctgcccccaccacgagcgcagctctgactacagcgatggtctcgcccctcctcag
catcttatccgggtggaagggaatttacgtgccaagtatttggatgacagaaacactttt
cgacacagtgtggtggtgccctacgaaccgccggaggtcggctctgactgtaccactatc
cactacaacttcatgtgtaacagctcctgcatggggggcatgaaccggcgacccatcctc
accatcatcacactggaggacgccagtggtaatctgctgggacgcaacagctttgaggtg
cgtgtttgtgcctgtcctgggagagaccgccgcacagaagaagaaaatttccgcaagaag
gggcagccttgccctgagctgccccctgggagcactaagcgagcactgcctaccagcagc
agctcctctccaccacaaaagaagaagccgctggatggagaatatttcactcttcagatc
cgcgggcgtgaacgtttcgagatgttccgggagctgaatgaggccttggagctgaaggat
gctcaggctgggaaggagccaggggaaaacaaggctcactctagccacctgaagtctaag
aaggggcagtctccctcccgccataaaaaactgatgttcaagagagaagggcctgactca
gactga

DBGET integrated database retrieval system