Camelus dromedarius (Arabian camel): 105103011 Help Entry 105103011         CDS       T04642                                  Gene name TP53 Definition (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk01522   Endocrine resistance cdk01524   Platinum drug resistance cdk04010   MAPK signaling pathway cdk04071   Sphingolipid signaling pathway cdk04110   Cell cycle cdk04115   p53 signaling pathway cdk04137   Mitophagy - animal cdk04151   PI3K-Akt signaling pathway cdk04210   Apoptosis cdk04211   Longevity regulating pathway cdk04216   Ferroptosis cdk04218   Cellular senescence cdk04310   Wnt signaling pathway cdk04722   Neurotrophin signaling pathway cdk04919   Thyroid hormone signaling pathway cdk05012   Parkinson disease cdk05014   Amyotrophic lateral sclerosis cdk05016   Huntington disease cdk05160   Hepatitis C cdk05161   Hepatitis B cdk05162   Measles cdk05163   Human cytomegalovirus infection cdk05165   Human papillomavirus infection cdk05166   Human T-cell leukemia virus 1 infection cdk05167   Kaposi sarcoma-associated herpesvirus infection cdk05168   Herpes simplex virus 1 infection cdk05169   Epstein-Barr virus infection cdk05200   Pathways in cancer cdk05202   Transcriptional misregulation in cancer cdk05203   Viral carcinogenesis cdk05205   Proteoglycans in cancer cdk05206   MicroRNAs in cancer cdk05210   Colorectal cancer cdk05212   Pancreatic cancer cdk05213   Endometrial cancer cdk05214   Glioma cdk05215   Prostate cancer cdk05216   Thyroid cancer cdk05217   Basal cell carcinoma cdk05218   Melanoma cdk05219   Bladder cancer cdk05220   Chronic myeloid leukemia cdk05222   Small cell lung cancer cdk05223   Non-small cell lung cancer cdk05224   Breast cancer cdk05225   Hepatocellular carcinoma cdk05226   Gastric cancer cdk05230   Central carbon metabolism in cancer cdk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105103011 (TP53)    04310 Wnt signaling pathway     105103011 (TP53)    04071 Sphingolipid signaling pathway     105103011 (TP53)    04151 PI3K-Akt signaling pathway     105103011 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     105103011 (TP53)   09143 Cell growth and death    04110 Cell cycle     105103011 (TP53)    04210 Apoptosis     105103011 (TP53)    04216 Ferroptosis     105103011 (TP53)    04115 p53 signaling pathway     105103011 (TP53)    04218 Cellular senescence     105103011 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     105103011 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     105103011 (TP53)   09149 Aging    04211 Longevity regulating pathway     105103011 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105103011 (TP53)    05202 Transcriptional misregulation in cancer     105103011 (TP53)    05206 MicroRNAs in cancer     105103011 (TP53)    05205 Proteoglycans in cancer     105103011 (TP53)    05203 Viral carcinogenesis     105103011 (TP53)    05230 Central carbon metabolism in cancer     105103011 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     105103011 (TP53)    05212 Pancreatic cancer     105103011 (TP53)    05225 Hepatocellular carcinoma     105103011 (TP53)    05226 Gastric cancer     105103011 (TP53)    05214 Glioma     105103011 (TP53)    05216 Thyroid cancer     105103011 (TP53)    05220 Chronic myeloid leukemia     105103011 (TP53)    05217 Basal cell carcinoma     105103011 (TP53)    05218 Melanoma     105103011 (TP53)    05219 Bladder cancer     105103011 (TP53)    05215 Prostate cancer     105103011 (TP53)    05213 Endometrial cancer     105103011 (TP53)    05224 Breast cancer     105103011 (TP53)    05222 Small cell lung cancer     105103011 (TP53)    05223 Non-small cell lung cancer     105103011 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     105103011 (TP53)    05014 Amyotrophic lateral sclerosis     105103011 (TP53)    05016 Huntington disease     105103011 (TP53)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105103011 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105103011 (TP53)    05161 Hepatitis B     105103011 (TP53)    05160 Hepatitis C     105103011 (TP53)    05162 Measles     105103011 (TP53)    05168 Herpes simplex virus 1 infection     105103011 (TP53)    05163 Human cytomegalovirus infection     105103011 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     105103011 (TP53)    05169 Epstein-Barr virus infection     105103011 (TP53)    05165 Human papillomavirus infection     105103011 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105103011 (TP53)    01522 Endocrine resistance     105103011 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cdk03000]     105103011 (TP53)    03036 Chromosome and associated proteins [BR:cdk03036]     105103011 (TP53)    03400 DNA repair and recombination proteins [BR:cdk03400]     105103011 (TP53) Transcription factors [BR:cdk03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     105103011 (TP53) Chromosome and associated proteins [BR:cdk03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      105103011 (TP53) DNA repair and recombination proteins [BR:cdk03400]  Eukaryotic type   Check point factors    Other check point factors     105103011 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  105103011 NCBI-ProteinID:  XP_010994816 UniProt:  A0A5N4D2L6 LinkDB All DBs Position 16 AA seq 381 aa AA seqDB search MEESQSELGVEPPLSQETFSDLWKLLPENNLLSSELSPAVDELLLSPEVTNWLDENPDEA PRMQEPPVPAAPAPATSWPLSSFVPSQKTYPGSYGFRLGFLHSGTAKSVTCTYSPPLNKL FCQLAKTCPVQLWVSSLPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERSSDYSDGLAPPQ HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRRPIL TIITLEDASGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQPCPELPPGSTKRALPTSS SSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGENKAHSSHLKSK KGQSPSRHKKLMFKREGPDSD NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atggaggagtcgcaatcagaactcggcgtggagccccctctgagtcaggagacgttttca gacttgtggaaactgctacctgaaaacaaccttctgtcctctgagctctccccagcagtg gatgaactactcctgtccccagaagttaccaactggttggatgagaatccagatgaagcc ccaagaatgcaagagcctcctgtccccgctgcccccgcaccagccacctcctggcccctg tcatcctttgtcccttcgcagaagacctaccctggcagctacggtttccgtcttgggttc ctgcattctgggacagccaagtctgtaacctgcacgtactcccctcccctcaacaagctg ttttgccagctggccaagacctgcccggtgcagctgtgggtcagctccctgcccccgccc ggcacccgggtccgcgccatggccatctacaagaagtcagagtacatgacggaggttgtg agacgctgcccccaccacgagcgcagctctgactacagcgatggtctcgcccctcctcag catcttatccgggtggaagggaatttacgtgccaagtatttggatgacagaaacactttt cgacacagtgtggtggtgccctacgaaccgccggaggtcggctctgactgtaccactatc cactacaacttcatgtgtaacagctcctgcatggggggcatgaaccggcgacccatcctc accatcatcacactggaggacgccagtggtaatctgctgggacgcaacagctttgaggtg cgtgtttgtgcctgtcctgggagagaccgccgcacagaagaagaaaatttccgcaagaag gggcagccttgccctgagctgccccctgggagcactaagcgagcactgcctaccagcagc agctcctctccaccacaaaagaagaagccgctggatggagaatatttcactcttcagatc cgcgggcgtgaacgtttcgagatgttccgggagctgaatgaggccttggagctgaaggat gctcaggctgggaaggagccaggggaaaacaaggctcactctagccacctgaagtctaag aaggggcagtctccctcccgccataaaaaactgatgttcaagagagaagggcctgactca gactga

DBGET integrated database retrieval system