KEGG   Camelus dromedarius (Arabian camel): 105103196Help
Entry
105103196         CDS       T04642                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00310  Lysine degradation
cdk04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105103196 (SETDB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105103196 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105103196 (SETDB1)
Enzymes [BR:cdk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105103196 (SETDB1)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105103196 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    105103196 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 105103196
NCBI-ProteinID: XP_010995046
LinkDB All DBs
Position
Un
AA seq 1296 aa AA seqDB search
MSSLPECIGLDAATAAVESEEIAELQQAVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLASTGTQFKPVEPPQPTAPPVPPTPPAPPAPPGPPLSPHAGD
NESLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENAPGGKPGINQAYRSPLGS
TPSTPAPPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSEQYR
GKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFL
EMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGK
GVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQVNPNSGYQYKRLEECLP
TGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGK
ILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGT
EDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGVSEMPSKDSRPPDLGPP
HIPVPPPIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGEGRAG
GGRGEAEKASTSGLGFKDEGDVKQAKKEDPDDRNKVSIVTESSRNYGYNPSPVKTEGLRR
PPSKTSMHQSRRLVASAQSSADDILTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQT
ISSGSEGDDFEDKKNMSGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPVRK
NTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRI
RAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccccgagtgcattggtttggatgcagcaaccgctgcagtggagtctgaa
gagattgcagaactgcaacaggcagtggttgaggagctgggtatctctatggaggaactt
cggcagttcatcgatgaagaactggaaaagatggactgtgtacagcagcgcaagaagcaa
ctagcagagttagagacatgggtgatacagaaggaatccgaggtggcccatgttgaccag
ctctttgatgatgcatccagggcagtgactaactgtgagtctttggtgaaggacttttat
tccaaactgggactacagtaccgggacagtagctctgaggatgaagcttcccggcctaca
gaaataattgagattcctgatgaagatgatgatgtcctcagtattgattcaggggatgct
gggagcagaactccaaaagaccagaagctccgtgaagctatggctgccttaagaaagtcg
gctcaggatgtccagaagttcatggatgctgtcaacaagaagagcagttcccaggatcta
cacaaaggaaccttgagtcagatgtctggagaactgagcaaagatggtgacctcatagtc
agcatgcgcattctgggcaagaagagaactaagacgtggcacaaaggcaccctcattgcc
atccagacggttgggccaggaaagaagtacaaggtgaaatttgacaacaaaggaaagagt
ctactgtcagggaaccacattgcctatgattaccaccctcctgctgacaagctgtatgtg
ggcagtcgagtagtggccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggc
tatgcttcctatgttacgcaatctgaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgagacttcatagaggagtatatcactgcttac
cccaaccgccccatggtgttgctcaagagtggccagcttatcaagactgagtgggaaggc
acgtggtggaagtcccgagtcgaggaggtggacggcagcctagtcagaatcctcttcctg
gatgacaaaagatgtgaatggatctatcgcggctctacacggctagagcccatgttcagc
atgaagacatcctcagcctctgcactggagaagaagcaagggggacagctcaggacacgt
ccgaacatgggtgctgtgaggagcaaaggtcctgtggtccagtatactcaggatctagcc
agtactggcacccagttcaagccagtagaacctccacagcctacagccccaccggtgcca
cctaccccacccgccccacctgccccacctggtccacctctgtccccccatgcaggtgac
aatgaaagcttggaaagccagcttgcccaatctcggaagcaggtagccaaaaagagcaca
tccttccggccaggatctgtgggctctggtcattcctcccctacatcccctgcactcagt
gaaaatgcccctggtgggaaacctgggatcaatcaggcgtatagatcacctttaggctca
acaccctctaccccagcacccccggctcccccagcacccccagccttccatggcatgctg
gagcgggccccggcagagccttcctaccgcgcccccatggagaagcttttctacttacct
cacgtctgcagctatacctgtctgtctcgagtcagacctatgagaagtgagcagtaccgg
ggcaaaaaccctctcctagtcccactactgtatgacttccggcggatgacagcccggcgc
cgagtcaaccgcaagatgggctttcatgttatctataagacaccctgtgggctctgcctt
cggacaatgcaggagattgagcgctacctttttgagactggctgtgacttcctcttcctg
gagatgttctgtttggatccatatgttcttgtggaccgaaagtttcagccctataagcct
ttttactatattttggacatcacctatgggaaggaagatgttcccctatcctgtgtcaat
gagattgacaccactcccccaccccaggtggcctacagcaaggaacgaattccgggcaaa
ggtgttttcattaacacaggccctgaatttctggttggatgtgactgcaaagatgggtgc
cgggacaagtccaagtgtgcctgccatcagctaactatccaggccacagcctgcacccca
ggtggccaggtcaaccctaactctggctaccagtacaagagactagaagagtgtctgccc
acgggggtttacgaatgtaacaaacgctgcaaatgtgatccaaacatgtgcacaaaccgg
ttggtgcagcatggactgcaggttcggctgcagctcttcaagacccagaacaagggctgg
ggtatccgctgcttggatgacattgcgaaaggctcctttgtctgtatttatgcaggcaaa
atcctgacagatgactttgcagacaaggagggcctggaaatgggtgatgagtactttgcc
aatctggaccacatcgagagcgtggagaacttcaaggaaggatatgagagcgatgccccc
tgttcctctgacagcagtggtgtagacttgaaggaccaggaagatggcaacagcggtaca
gaggaccccgaagagtccaatgacgatagctcagatgataacttctgtaaggatgaggac
ttcagcaccagctcagtgtggcgcagctatgctacccggaggcaaacccggggccagaag
gagaatggagtgtctgagatgccttccaaggactcccgcccccccgaccttgggccccca
catattcctgtccctccaccaatccctgtaggtggctgcaatccaccttcctctgaagag
acacccaagaacaaggtggcctcatggttgagctgcaatagtgtcagtgaaggtggcttt
gctgactctgacagccgttcatcctttaagactagtgaagggggggaaggccgggctggg
ggaggcagaggggaggctgagaaagcctccacctcagggctgggcttcaaggatgagggc
gacgtcaagcaggccaagaaagaggaccctgatgaccgaaacaaggtgtcaatagttact
gaaagctctcgaaattatgggtacaatccttctcctgtgaagactgaaggacttcgccgc
ccaccaagtaagactagtatgcatcagagccgacgactcgtggcctccgctcagtccagt
gctgacgatatcctgacgctgtccagcagcacagaaagcgagggggaaagtgggaccagc
cgaaagcccactgctgggcagacttcagccacagccgttgacagtgatgatatccagacc
atctcctctggctctgaaggggatgactttgaggacaagaagaacatgtctggtccaatg
aagcgccaagtggcagtaaaatcaacccggggttttgctcttaaatcaacccatgggatt
gccattaagtcaaccaacatggcgtccgtggaaaagggggagagcgctcctgttcgtaag
aacacacgccagttctacgatggtgaggagtcttgctacatcattgatgccaagcttgaa
ggcaacctgggccgctacctcaatcacagttgcagccccaacctgtttgtccagaatgtc
ttcgtggatactcatgatcttcgcttcccctgggtggccttttttgccagcaagagaatc
cgggctgggacagaactcacctgggactacaactacgaggtgggcagcgtggaaggcaag
gagctgctgtgctgctgtggggccatcgaatgcagagggcgtcttctttag

DBGET integrated database retrieval system