KEGG   Camelus dromedarius (Arabian camel): 105103240Help
Entry
105103240         CDS       T04642                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04371  Apelin signaling pathway
cdk05034  Alcoholism
cdk05165  Human papillomavirus infection
cdk05169  Epstein-Barr virus infection
cdk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105103240 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    105103240 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    105103240 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    105103240 (HDAC4)
   05165 Human papillomavirus infection
    105103240 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105103240 (HDAC4)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105103240 (HDAC4)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     105103240 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 105103240
NCBI-ProteinID: XP_010995109
LinkDB All DBs
Position
Un
AA seq 843 aa AA seqDB search
MDLRLDHQFPLPVAEPALREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQL
HEHIKQQQELLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVAS
TEVKMKLQEFVLNKKKALAHRSLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGVSASCNHP
VLGLYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVT
DSACSSAPGSAPSSPNNSSGNVSTENGIAPAVPSIPTEASLAHRLVTREGSVGPLPLYTS
PSLPNITLGLPATGPSAVSRHPWVCVAVTPSGCRLALPALQQRLSLFPGTHLAPYLSTAP
LERDAGAAHSSLLQHMVLLEQPPAQTPLVTGLGALPLHAQPLVGAERVSPSVHKLRPHRP
LGRTQSAPLPQNAPGLQHLVIQQQHQQFLEKHKQQFQQQQLHVSKIIPKPSEPARQPESH
PEETEEELREHQALLEEPFLDRLSGQKEALALAGVQVKQEPLESDDEEVEPPREAEPGQR
QPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPM
SVQEPPSKPRFTTGLVYDTLMLKHQCACGNTNSHPEHAGRIQSIWSRLQETGLRGKCECI
RGRKATLEELQTVHSEAHALLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTI
WNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEENTPMGFCYFNSVAIA
AKLLQQRLNVTKTLVVDWDVHHGNGTQQAFYSDPSVLYISLHRYDDGNFFPGSGAPDEVG
GSP
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgcctggaccaccagttcccactgcccgtggcggagcctgcgctccgggag
cagcagctgcagcaggagctcctggccctgaagcagaagcagcagctccagaggcagatc
ctcatcgctgagttccagaggcagcacgagcagctgtcccggcagcacgaggcccagctc
cacgagcacatcaaacaacagcaggagctgctggccatgaagcaccagcaggagctgctg
gagcatcagcggaagctggagcgacaccgccaggagcaggagctggagaagcagcaccgg
gagcagaagctgcagcagctcaagaacaaggagaaaggaaaagagagtgcggtggcgagc
acggaagtgaagatgaagctgcaggagtttgtcctcaacaagaagaaggcgctggcccac
cggagcctgaaccactgcatgtccagcgaccctcgctactggtacgggaagacgcagcac
agctccctggaccagagctccccgccgcagagcggggtgtcagcctcctgcaaccaccca
gtcctgggcctgtacgacgccaaggacgactttcctctcagaaagacagcttctgagcca
aatctgaaattacgctccaggctaaagcagaaagtggctgaaagacggagcagccccctg
ttacgcaggaaagatgggccggtggttaccgcgctgaagaagcgtccgctggatgtcact
gactccgcgtgcagcagtgccccgggctccgcccccagctcgcccaacaacagctccggg
aacgtcagcacggagaatgggatcgcgcccgccgtccccagcatcccgaccgaggccagc
ttggcgcacagactggtgacccgggaaggctccgtgggcccgctgcccctctacacgtca
ccctccttgcccaacatcacgctgggacttcctgccaccggcccatctgctgtaagtagg
catccgtgggtctgcgtggcggtgacccccagcggctgtcggctggccctcccagccctc
cagcagcgcctctctctgtttcccggcacccacctcgccccctacctgagcacggcgccc
ctggagcgggacgcgggggcggcgcacagctccctcctgcagcacatggtcctcctggag
cagccgcccgcacagacgcccctcgtcacaggcctgggcgcgctgcccctgcacgcacag
cccctggtgggggcggagcgcgtgtccccatctgtgcacaagctgcggccgcaccgcccg
ctggggcgcacccagtcggcgcccctgccccagaacgcgccgggcctgcagcacctggtg
atccagcagcagcaccagcaattcctggagaagcacaagcagcagttccagcagcagcag
ctgcacgtgagcaagatcatccccaagccgagcgagccggcccggcagcccgagagccac
cctgaggagacggaggaggagctgcgggaacaccaggccctcctggaggagcccttcctg
gaccggctctcagggcagaaggaggcgctcgcgctggccggggtgcaggtgaagcaggag
cccctcgagagtgacgacgaggaggtggagcccccccgggaggcggagccgggccagcgg
cagcccaccgagcaggagctgctcttcagacagcaagccctcctgctggagcagcagcgg
atccaccagctgaggaactaccaggcatccatggaggccgccggcatccctgtgtccttt
ggcggccaccggcctctgtcccgggcacagtcctcccctgcgtccgccaccttccccatg
tctgtgcaggagccccccagcaagccgcgtttcaccacaggcctggtgtacgacacgctg
atgctgaagcaccagtgcgcctgcggcaacaccaacagccacccagagcatgccgggagg
atccagagcatctggtcccggctgcaggagaccggcctgcgcggcaaatgcgagtgcatc
cgtggtcggaaggccaccctggaggagctgcagacagtgcattcggaggcgcatgccctg
ctctacggcacgaaccccctcaacaggcagaaactggacagtaagaaacttctaggctcc
ctaacgtcggtgtttgtcaggctgccctgtggtggtgtcggggtggacagtgacaccatt
tggaacgaggtgcactcatcgggggcggcccgcctggccgtgggctgcgtggtggagctg
gtcttcaaggtggccacgggggagctgaagaacggctttgctgtggtccgcccccccggc
caccacgcagaggagaacacacccatggggttctgctacttcaactccgtggccatcgca
gccaagctcctccagcaaaggctgaatgtgaccaagaccctcgtcgtggactgggatgtg
caccacgggaacgggacccagcaggccttctacagcgaccccagcgtcctgtacatctcc
ctgcaccgctacgatgatggaaacttcttcccgggcagcggggcgcctgacgaggtgggc
ggcagcccg

DBGET integrated database retrieval system