KEGG   Camelus dromedarius (Arabian camel): 105103397
Entry
105103397         CDS       T04642                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04144  Endocytosis
cdk04151  PI3K-Akt signaling pathway
cdk04510  Focal adhesion
cdk04540  Gap junction
cdk04630  JAK-STAT signaling pathway
cdk04810  Regulation of actin cytoskeleton
cdk05163  Human cytomegalovirus infection
cdk05200  Pathways in cancer
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105103397 (PDGFRA)
   04014 Ras signaling pathway
    105103397 (PDGFRA)
   04015 Rap1 signaling pathway
    105103397 (PDGFRA)
   04630 JAK-STAT signaling pathway
    105103397 (PDGFRA)
   04020 Calcium signaling pathway
    105103397 (PDGFRA)
   04072 Phospholipase D signaling pathway
    105103397 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    105103397 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105103397 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105103397 (PDGFRA)
   04540 Gap junction
    105103397 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105103397 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105103397 (PDGFRA)
   05206 MicroRNAs in cancer
    105103397 (PDGFRA)
   05230 Central carbon metabolism in cancer
    105103397 (PDGFRA)
   05231 Choline metabolism in cancer
    105103397 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    105103397 (PDGFRA)
   05218 Melanoma
    105103397 (PDGFRA)
   05215 Prostate cancer
    105103397 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    105103397 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105103397 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105103397 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cdk04090]
    105103397 (PDGFRA)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105103397 (PDGFRA)
Protein kinases [BR:cdk01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   105103397 (PDGFRA)
CD molecules [BR:cdk04090]
 Proteins
  105103397 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 105103397
NCBI-ProteinID: XP_010995287
LinkDB
Position
2
AA seq 1089 aa
MGTSHQTLLVLGCLLTGPSLILCQLSLPSILPNDNEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVKVLEVVSASAAHTGLYTCYYNHTQMEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLSGDNVVHASYDSRQGFNG
TFTVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGELIVVTCAVFNN
EVVDLQWTYPGQVKGKGVTMLEETKVPYIKLVYTLRVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVNLHEVKHFVVDVQAYPPPKISWLKDNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVVENEDDMKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCAAEGTPLPDIEWMICKDIKKCNNETSWTILANNISNIITEVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGAESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPGDESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRMDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatcagacacttctggtcttaggctgtctcctcacagggcccagccta
atcctctgccagctttcattaccctccatccttccaaatgataacgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgaaggtgctggaggtggtcagtgcctcggcggcccacacgggtttgtacacctgc
tattacaatcacacgcagatggaggagagcgagatcgaaggcagacgcatctacatctat
gtgccggacccagatgtagccttcgtacctctagggatgacagattatttggtcatcgtg
gaggatgatgattccgccatcatcccttgtcgcacgactgatccggagactccagtgacc
ttgctcagcggtgacaacgtggtgcacgcctcctatgacagcagacaaggctttaacgga
accttcaccgttgggccctatatctgtgaggccaccgtcagagggaagaagttccagacc
atcccattcaatgtttatgctttaaaagcaacatcagaacttgacctggaaatggaagct
ctgaaaactgtgtataagtcaggggaattgattgtggtcacctgcgccgtctttaacaat
gaagtagttgaccttcagtggacttaccctggacaagtgaagggcaaaggcgtcacgatg
ctggaggaaaccaaggtcccgtacatcaaattggtgtacactctgagggtccccgaggcc
acggtgaaagacagcggagattacgaatgtgctgcccgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatttctgtccatgagaaagggtttattgaaatcaaacccaac
ttcagcccattggaagctgtcaacctgcatgaagtcaaacattttgtggtagatgtgcag
gcctacccacctcccaagatatcctggctgaaggacaacctgactctgattgagaatctc
acggagatcactacggacgtagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgggccaaggaagaagacagtggccattataccatcgtagttgaaaacgaggat
gacatgaagagctacacgtttgaactcttaactcaagttccgtcatccattctggacttg
gtcgacgaccaccatggctctaacgggggacagacagtgagatgtgcagctgaagggacc
cctcttcctgacattgagtggatgatttgcaaggatattaagaaatgtaataatgaaact
tcatggacgattttggccaacaatatctccaacatcatcacggaggtccacccccgagac
aggagcacggtggagggccaggtgacatttgccaaagtggaggagaccattgcagttcga
tgcctggcaaagaacctccttggggctgagagccgagaactgaagctggtggcacccact
ctgcgatctgaactcacagtggcagctgcagtcctggtgctgctggtgatcgtgatcatc
tccctcattgtcctggttgtcatttggaaacagaaaccaaggtatgaaattcgttggagg
gtcattgaatcaatcagccccgatggacatgaatatatttatgtggacccaatgcagctg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctgggg
tctggtgcatttgggaaagtggttgaaggaactgcctatggattaagccggtcccaacct
gtcatgaaagtagctgtgaagatgctaaaacccacagccagatccagtgagaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccacatttaaacattgtgaacttg
ctgggagcctgtaccaagtcaggtcccatttacatcatcactgagtactgcttctacggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccaccacccagagaag
ccaaagaaagagctggacatttttggattgaaccctggggatgaaagcacacggagttac
gttattttatcttttgaaaacaatggggactacatggacatgaagcaagctgatactaca
cagtacgtccccatgctggagaggaaagaggtgtctaaatactcagacatccagagatca
ctgtatgatcgcccagcctcgtacaagaagaagtcgatgctagactctgaagtcaaaaac
ctcctgtcagatgataactcagaaggccttactctgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcacaagggaagatcgtgaagatctgtgactttggtctggcc
agagacatcatgcatgattcgaactatgtgtcgaaaggcagcacctttctcccagtgaag
tggatggcccctgaaagcatcttcgacaacctctacaccaccctgagtgacgtctggtct
tacggcattctgctctgggagatcttttcccttggtggcactccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccggagaagaga
ccctcattttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttacgaaaagatccacctggacttcctgaagagcgaccatcccgccgtggcacgcatg
cgcatggactccgacaatgcctacattggcgtcacctacaaaaacgaagaggacaagctg
aaggactgggaggggggcctcgatgagcagaggctgagcgcagacagcggctacatcatc
cccttgcccgacatcgaccctgttcctgaggaggaagaccttggcaagaggaacagacac
agctcgcagacgtctgaagagagtgccattgagacaggctccagcagttccaccttcatc
aagagagaggacgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system