KEGG   Camelus dromedarius (Arabian camel): 105103612Help
Entry
105103612         CDS       T04642                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     105103612 (TMPRSS9)
Peptidases [BR:cdk01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105103612 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 105103612
NCBI-ProteinID: XP_010995526
LinkDB All DBs
Position
Un
AA seq 1016 aa AA seqDB search
MEPATGDLELVPGASKDVLAADTPCCRVVLVSVVATSIVIVTLGVLVASLSTQGAHVEHT
AELQGIRFAPSLQQATSDYYRTLTPALETLFVSSFRKTELQASCVGCTVLSYRDGNSSVL
VHFRLHFLQQALRTLSLELEEELLQQGLRAGLQGRGIPLAAYGTIVSAQLTGNHKGPPME
RDLKSGRCPGNAFSCGNGQCVTKGNPECDGTADCSDGSDEARCDCGLQPGWRITGRIVGG
VGASPGEFPWQVSLRENNEHFCGAAVVSARWLVSAAHCFNEFQEPTEWVAYAGTTFLSGS
EASTVRARVARIIRHPSYDPDTADFDLAVLELQGPLPFSRHVQPVCLPAATHVFPPGKKC
LISGWGYLKEDFLVKPETLQKATVELLDQALCANLYGHSLTDRMLCAGYLDGKVDSCQGD
SGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWILEAITTASKPLAPTV
APTPAVPSTAWPTSSESLVADTPAKPALALGTPPLHSATASKPQECGARPVLEKPTRIVG
GFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAHLGTTSLSGI
GGSPVKVGLKRAVLHPQYNPSILDFDVAVLELARPLVFNKHVQPVCLPLAIQKFPVGRKC
IISGWGNTEEGNATKPDILQWASVGIIDQKACSALYNFSLTDRMICAGFLEGRVDSCQGD
SGGPLACEETPGVFYLAGIVSWGIGCAQARKPGVYTRITRLKGWILDTMAFQPLPTPPPP
TARMPSSSPTSRATAGLTVPGVVASTPTPRATSQPANRTATGLTTATRGQTPLPHALEVT
AGPQLPDCGLAPVATLTRIGGGSAAGRGEWPWQVSLWLRRREHRCGAVLVADKWLLSAAH
CFDVYGDPRQWAAFLGTPFLSGAGGQLERVARIHRHPFYNLYTLDYDVALLELAGPVSHG
RLVRPICLPEPGPRPPDGARCVITGWGSMREGGSMARQLQKAAVRLLSEQTCRRFY
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atggaacctgccaccggggacttagaactggtgcccggggcctccaaggatgtcctggct
gcggacaccccgtgctgccgggtggtcctcgtgtctgtggtggccaccagcatcgtcatc
gtcaccctgggagtccttgtggcctcgctctctacacagggcgcccacgtggagcacacg
gccgagctgcagggcatccggtttgcacccagcttgcagcaggcgacctcggactactac
cgcacgctgacgcccgccctggaaacgctgtttgtaagcagctttcggaagacagagctg
caggccagctgcgtgggctgcacggtgctgagttacagggacgggaactccagcgtcctc
gtgcatttccggctgcactttctgcagcaagccctccggacgctgagcctggagctggag
gaggagctgttacagcaggggctccgggccgggctgcagggacgcggcatccccctggcc
gcctacggcaccatcgtgtccgcccagctcacaggcaaccacaaggggccaccgatggaa
agagacttaaaatcaggtcgctgtcctgggaacgccttttcctgcgggaacggccagtgt
gtgaccaagggcaacccggagtgtgacggcacagcagactgctccgacggctccgacgag
gcccgctgtgactgtggtttgcagcctggctggaggatcaccggcaggattgtgggtggt
gtgggagcatccccaggggagttcccttggcaagtcagcctccgagaaaacaacgaacac
ttctgtggagccgctgtcgtcagtgccaggtggttggtgtctgctgcccactgcttcaac
gagttccaggagcccacggagtgggtggcctacgcgggcactaccttcctcagcggctcg
gaggccagcacggtgcgggcccgcgtggcccggatcatcaggcacccctcctacgacccg
gacacggccgacttcgacctggcggtgctcgagctgcaaggccccctgcccttcagcaga
cacgtgcagccggtgtgcctcccggccgccacccacgtcttcccgcctgggaagaagtgt
ctgatctcgggctggggctacctcaaggaggacttcctggtcaagccggagacgctgcag
aaggccaccgtggagctgctggaccaggccctgtgcgccaacctgtacgggcactcgctc
accgacaggatgctctgcgccggctatctggatgggaaggtggattcctgccagggcgac
tcgggaggacccctggtctgcgaggagccctctggcaggtttttcctggctggcattgtg
agctggggaattggttgtgcggaagcccggcgtccaggggtctacgctcgagtgaccagg
ctgcgtgactggatcctggaggccatcaccacagcaagcaagcctctggcccccacggtg
gctcccacccccgctgtccccagcactgcctggcccaccagctccgagagcctggtggcc
gacacccctgccaaacctgcgctggccctcggcaccccacctctccactcagccaccgct
tctaagccgcaagagtgcggggccaggccggtgctggagaagcccacccggatcgtgggc
gggtttggagctgcctccggagaggtgccctggcaggtcagcctgaaggaggggtcccgg
cacttctgcggagccaccgtggtgggggatcgctggctgctgtcagctgcccactgcttc
aatcacacgaaggtggagctggtgcgggcccatctgggcaccacatccctctcgggcatc
ggcgggagccccgtgaaggtggggctcaagcgggcagtgctgcacccccagtacaacccc
agcatcctggacttcgatgtggccgtgctggagctggcccggcccctggtcttcaacaag
cacgtgcagcccgtctgcctccccctggccatccagaagttccccgtgggccggaagtgc
atcatctctggatggggtaacacggaggagggaaatgccaccaagccggacatcctccag
tgggcgtccgtgggcatcatagaccagaaggcgtgcagcgccctctacaacttctcgctc
acggacaggatgatctgtgccggcttcctggagggcagggtcgactcctgccagggtgac
tctgggggacccctggcctgtgaggagacccctggcgtgttttacttggcgggcatcgtg
agctggggcatcggctgtgcccaggccaggaaaccaggcgtgtacacgcgaatcaccagg
ctgaagggctggatcctggacaccatggccttccagcccctccccacacccccgccgccc
accgcgaggatgccctccagcagtcccaccagcagggccacagctggcctcacagtccca
ggggttgtggccagcacacccactccccgggccaccagccaacctgccaacaggactgcc
accggcctgaccacagctaccaggggacagacaccacttccacatgccctagaggtcacc
gcgggcccccagctcccagactgcggcctggcgccggtggccacactgaccaggatcggg
ggtggcagtgctgcaggccgtggggagtggccgtggcaggtgagcctgtggctgcggcgg
cgggagcaccgctgtggggccgtgctggtggctgacaagtggctgctgtcggcagcgcac
tgcttcgatgtctacggggaccccaggcagtgggcggccttcctgggcacgccgttcctg
agtggcgccggcgggcagctggagcgcgtggcgcgcatccacaggcaccccttctacaac
ctgtacacgctcgactacgacgtggcgctgctcgagctggcggggcccgtgagccacggc
cgcctggtgcggcccatctgcctgcccgagccggggccccggccccccgacggagcacgc
tgtgtcatcactggctggggctccatgcgcgagggaggctccatggcgcggcagctgcag
aaggcggccgtgcgcctcctcagtgagcagacctgccgccgcttctac

DBGET integrated database retrieval system