KEGG   Camelus dromedarius (Arabian camel): 105104178
Entry
105104178         CDS       T04642                                 

Definition
(RefSeq) fatty acid-binding protein, liver
  KO
K08750  fatty acid-binding protein 1, liver
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105104178
  09154 Digestive system
   04975 Fat digestion and absorption
    105104178
SSDB
Motif
Pfam: Lipocalin_7
Other DBs
NCBI-GeneID: 105104178
NCBI-ProteinID: XP_031297151
LinkDB
Position
28
AA seq 126 aa
MNFSGKYELQSQENFEAFMKAVGLPDDLVQKGKDTKEVTEVVQNGKHFKFTVTAGPKVFQ
NEFTVGEESEMETMTGEKVKAVVQLEGENKLVTTFKGIKSVTELNGDTITSTMTLATCLE
ENQKRV
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaacttctccggcaagtacgaactgcagagccaggaaaatttcgaggccttcatgaag
gccgtcggtctgcccgacgacctcgtccagaagggcaaggacactaaggaggtgacagaa
gtcgtgcagaacgggaagcatttcaagtttactgtcactgctgggcccaaagtgttccag
aacgagttcactgtgggtgaggagagtgagatggagaccatgaccggggagaaggtcaag
gcagtggttcagctggaaggtgagaataaactggtgacaactttcaaaggcatcaagtct
gtgactgaattgaatggtgacacaatcaccagtaccatgactttggcgacatgtcttgaa
gagaatcagaaaagagtttag

KEGG   Camelus dromedarius (Arabian camel): 105106653
Entry
105106653         CDS       T04642                                 

Definition
(RefSeq) fatty acid-binding protein, liver
  KO
K08750  fatty acid-binding protein 1, liver
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105106653
  09154 Digestive system
   04975 Fat digestion and absorption
    105106653
SSDB
Motif
Pfam: Lipocalin_7 Glyco_hydro_42M
Other DBs
NCBI-GeneID: 105106653
NCBI-ProteinID: XP_031297150
LinkDB
Position
28
AA seq 127 aa
MNFSGKYELQSQENFEAFMKAVGLPDDLVQKGKDTKEVTEVVQNGKHFKFTVTAGTRVIQ
NEFTLGEESEMETMTGEKVKAVVQLEGENKLVTTFKGIKSVTELNGDTITSTMTLGDIVL
KRISKRV
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaacttctccggcaagtacgaactgcagagccaggaaaatttcgaggccttcatgaag
gccgtcggtctgcccgacgacctcgtccagaagggcaaggacactaaggaggtgacagaa
gtcgtgcagaacgggaagcatttcaagtttactgtcactgccgggaccagagtgatccag
aatgagttcaccctgggggaggagagtgagatggagaccatgaccggggagaaggtcaag
gcagtggttcagctggaaggtgagaataaactggtgacaactttcaaaggcatcaagtct
gtgactgaattgaatggtgacacaatcaccagtaccatgactttgggcgacattgtcttg
aagagaatcagcaaaagagtttag

DBGET integrated database retrieval system