KEGG   Camelus dromedarius (Arabian camel): 105104317Help
Entry
105104317         CDS       T04642                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00590  Arachidonic acid metabolism
cdk01100  Metabolic pathways
cdk04611  Platelet activation
cdk04726  Serotonergic synapse
cdk04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105104317 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105104317 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    105104317 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    105104317 (PTGS1)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     105104317 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 105104317
NCBI-ProteinID: XP_010996293
LinkDB All DBs
Position
Un
AA seq 601 aa AA seqDB search
MSRRRSLSLWFPLLLLLLLPPPVLPADPWAPAPVNPCCYYPCQHKGVCVRFGLDRYQCDC
TRTGYYGPNCTIPQLWTWLRTSLRPSPSFLHFLLTHGRWFWEFVNATFIRDLLMRLVLTV
RSNLIPSPPTYNLAHDYISWESFSNVSYYTRILPSVPQDCPTPMGTKGKKQLPDAELLSR
HFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLE
RQYHLRLFKDGKLKYQVLDGEVYPPSVEEAPVLMHYPRGVPPRSQMAVGQEVFGLLPGLM
LYATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQL
KFDPELLFGVQFQYRNRIAVEFNQLYHWHPLMPDAFRVGPRDFSYEQFLFNTSMLVDYGV
EALVDAFSRQTAGRIGGGRNIDAHILHVAVDVIKESRALRLQPFNEYRKRFGMKPYTSFQ
ELTGEQEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPI
CSPEYWKASTFGGETGFNIVKTATLRKLVCLNTKTCPYVSFRVPDPGQEDGPGVERPSTE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcggcggagtctctcgctctggttcccgctgctcctgctgctgctgctgccg
cccccggtcctgcccgcggacccctgggcgcccgcgccggtgaacccctgctgttactat
ccgtgccagcacaagggtgtctgtgtccgcttcggccttgaccgctaccagtgtgactgc
acccgcacgggctattacggccccaactgcaccatccctcagctctggacctggctccgg
acgtctttgaggccgagcccctctttcctccacttcctgctgacacatgggcgctggttc
tgggagtttgtcaatgccaccttcatccgtgacttgctcatgcgcctggtactcacagtg
cgttccaatcttatccccagcccccctacctacaacttagcgcacgactacatcagctgg
gagtccttctccaacgtgagctattacacgcggattctgccctctgtgccccaagactgc
cccacacccatggggaccaaagggaagaagcagttgccagatgccgagctcctgagccgt
cacttcctgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgcc
ttctttgcgcaacacttcactcaccagttcttcaaaacttctggcaagatgggtcctggc
ttcaccaaggcattgggccacggggtagacctcggccacatttatggggacaatctagaa
cgtcagtatcacctgcggctctttaaggatgggaagctcaagtaccaggtgctggacgga
gaggtgtacccgccgtcggtggaagaggcgcccgtgctgatgcactacccgcggggcgtc
ccgccccggagccagatggccgtgggccaggaggtgttcgggctgctgccggggctcatg
ctctacgccacgctctggctgcgggagcacaaccgcgtgtgtgacctgctgaaggccgag
caccccacctggggcgacgagcagctcttccagacggcccgcctcatcctgatcggggag
actatcaagattgtgatcgaggagtatgtgcagcagctgagcggctacttcctgcagctc
aagttcgacccggagctgctgttcggcgtccagttccagtaccgcaaccgcatcgccgtg
gagttcaaccagctctaccactggcacccgctcatgcccgacgccttcagggtgggcccc
cgggacttcagctacgagcagttcctcttcaacacctccatgctggtggactacggggtc
gaggccctggtggacgccttctctcgccagacggctggccggatcggtggggggaggaac
atagatgcccacatcctgcacgtggccgtggatgtcatcaaggagtcgcgagcgctgcgg
ctgcagcccttcaacgagtaccgcaagaggtttggcatgaaaccctacacctccttccag
gagctcacaggagagcaggagatggcagctgagctggaggagctatatggagacattgat
gccttggagttctacccgggactacttcttgagaagtgccacccaaactccatctttggg
gagagtatgatagaaattggggctcccttttcccttaagggtctcttagggaatcccatc
tgttctccggagtactggaaggcgagcacatttggtggcgagacgggcttcaacattgtc
aagacagccacgctgaggaagctggtttgcctcaataccaagacttgtccctatgtctcc
ttccgcgtgccagaccccggccaggaggacgggcctggtgtggagcggccatccaccgag
ctctga

DBGET integrated database retrieval system