KEGG   Camelus dromedarius (Arabian camel): 105104393
Entry
105104393         CDS       T04642                                 

Gene name
CCND1
Definition
(RefSeq) LOW QUALITY PROTEIN: G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04115  p53 signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04218  Cellular senescence
cdk04310  Wnt signaling pathway
cdk04340  Hedgehog signaling pathway
cdk04371  Apelin signaling pathway
cdk04390  Hippo signaling pathway
cdk04510  Focal adhesion
cdk04530  Tight junction
cdk04630  JAK-STAT signaling pathway
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04934  Cushing syndrome
cdk05160  Hepatitis C
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105104393 (CCND1)
   04340 Hedgehog signaling pathway
    105104393 (CCND1)
   04390 Hippo signaling pathway
    105104393 (CCND1)
   04371 Apelin signaling pathway
    105104393 (CCND1)
   04630 JAK-STAT signaling pathway
    105104393 (CCND1)
   04068 FoxO signaling pathway
    105104393 (CCND1)
   04151 PI3K-Akt signaling pathway
    105104393 (CCND1)
   04152 AMPK signaling pathway
    105104393 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105104393 (CCND1)
   04115 p53 signaling pathway
    105104393 (CCND1)
   04218 Cellular senescence
    105104393 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105104393 (CCND1)
   04530 Tight junction
    105104393 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    105104393 (CCND1)
   04921 Oxytocin signaling pathway
    105104393 (CCND1)
   04919 Thyroid hormone signaling pathway
    105104393 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105104393 (CCND1)
   05206 MicroRNAs in cancer
    105104393 (CCND1)
   05205 Proteoglycans in cancer
    105104393 (CCND1)
   05203 Viral carcinogenesis
    105104393 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105104393 (CCND1)
   05212 Pancreatic cancer
    105104393 (CCND1)
   05225 Hepatocellular carcinoma
    105104393 (CCND1)
   05226 Gastric cancer
    105104393 (CCND1)
   05214 Glioma
    105104393 (CCND1)
   05216 Thyroid cancer
    105104393 (CCND1)
   05221 Acute myeloid leukemia
    105104393 (CCND1)
   05220 Chronic myeloid leukemia
    105104393 (CCND1)
   05218 Melanoma
    105104393 (CCND1)
   05219 Bladder cancer
    105104393 (CCND1)
   05215 Prostate cancer
    105104393 (CCND1)
   05213 Endometrial cancer
    105104393 (CCND1)
   05224 Breast cancer
    105104393 (CCND1)
   05222 Small cell lung cancer
    105104393 (CCND1)
   05223 Non-small cell lung cancer
    105104393 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    105104393 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105104393 (CCND1)
   04934 Cushing syndrome
    105104393 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105104393 (CCND1)
   05162 Measles
    105104393 (CCND1)
   05160 Hepatitis C
    105104393 (CCND1)
   05163 Human cytomegalovirus infection
    105104393 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105104393 (CCND1)
   05169 Epstein-Barr virus infection
    105104393 (CCND1)
   05165 Human papillomavirus infection
    105104393 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105104393 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 105104393
NCBI-ProteinID: XP_031303929
LinkDB
Position
Unknown
AA seq 296 aa
MAHQLLMLTKSGTIRRAYPMPNXLNDRVLGAMLKAEETCAPSVSYFKCVQKEILPSMRKI
VATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPL
TAEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIR
KHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGGSSSFLSYHRLTRFLSKVIRC
DPDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgatgctgacgaagagtgggaccatccgccgggcgtacccgatg
ccaaacnccctcaacgaccgggtgctgggggccatgctcaaggcggaggagacctgtgcg
ccctccgtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatc
gtggccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccg
ctggccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctg
cagctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctg
acggccgagaagttgtgcatctacactgacaactccatccggcccgacgagctgctgcaa
atggagttgctcctggtgaacaaactcaagtggaacctggcggccatgaccccgcacgac
ttcatcgagcacttcctctccaaaatgccggtggctgaggagaacaaacagatcatccgc
aaacacgcgcagaccttcgtcgccctttgtgccacagacgtgaagttcatttccaacccg
ccctccatggtggctgctgggagtgtggttgccgcggtgcaaggcctgcacctgggaggc
tccagcagcttcctgtcttaccaccgcctcacgcggttcctttccaaagtgatcaggtgt
gacccggactgcctccgtgcgtgccaggagcagatcgaagccctcctggagtccagcctg
cgccaggcccagcagcagaacctggaccccaaggccgcagaggaggaggaggaagaggag
gaggtcgacctggcctgcacgcccaccgacgtgcgggacgtgaacatttga

DBGET integrated database retrieval system