KEGG   Camelus dromedarius (Arabian camel): 105104668
Entry
105104668         CDS       T04642                                 

Gene name
ERG
Definition
(RefSeq) transcriptional regulator ERG isoform X3
  KO
K09435  transcriptional regulator ERG
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk05202  Transcriptional misregulation in cancer
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    105104668 (ERG)
  09162 Cancer: specific types
   05215 Prostate cancer
    105104668 (ERG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105104668 (ERG)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    105104668 (ERG)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 SAM_2 SAM_1
Other DBs
NCBI-GeneID: 105104668
NCBI-ProteinID: XP_010996721
LinkDB
Position
1
AA seq 479 aa
MASTIKEALSVVSEDQSLFECAYGTPHLAKTDMTASSSGDYGQTSKMSPRVPQQDWLSQP
PARVTIKMECNPSQVNGSRNSPDECSLAKGGKMVSSPDTVGMSYGSYMEEKHMPPPNMTT
NERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVDILLFQNIDGKELCKMTKDDFQRLT
PSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGATFIFPNTSVYPEA
TQRITTRPDLPYEPPRRSAWTSHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPYQILGPTS
SRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGS
YHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNARLPASHMPSHLGTYY
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggccagcacgattaaggaagcgttgtctgtcgtgagtgaggaccagtcattgtttgag
tgcgcctacggcacgccgcacctggccaagacggacatgactgcgtcctcctccggcgac
tatggacagacatccaagatgagcccgcgcgttcctcagcaggactggctgtctcaaccc
ccagccagggtcaccatcaagatggaatgtaaccccagtcaggtgaacggctcaagaaac
tcccccgacgagtgcagcctggccaaaggcgggaagatggtgagcagccccgacaccgtg
gggatgagttacggcagctacatggaggagaagcacatgccgcccccaaacatgacgacg
aacgagcgcagggtcatcgtccccgcagatcctacactatggagtacagaccacgtccgg
cagtggctggagtgggcagtgaaagaatacggccttccggacgtcgacatcttattattt
cagaatatcgatggaaaggaactgtgcaagatgaccaaagacgactttcagaggctcacc
ccgagctacaatgctgacatccttctgtcgcatctccactacctcagagagacacctctt
ccacatttgacttccgatgatgttgataaagccttacaaaactctccacggttaatgcat
gctagaaacacagggggtgcaacttttattttccccaatacttcagtatatcctgaagcc
acgcaaagaattacaactaggccagatttaccttacgaaccacccaggagatcagcctgg
accagtcatggccaccccaccccccagtcaaaagctgctcagccgtctccttccacagtg
cccaaaactgaagaccagcgtcctcaactagatccttatcagattcttggaccaacgagt
agccgccttgctaatccagggagcgggcagatccagctgtggcagtttcttctggagctc
ctgtcagacagctcaaactccaactgcatcacctgggaaggcaccaacggggagttcaag
atgacagatccggacgaggtggcccggcgctggggagaacggaaaagcaaacccaatatg
aactatgataaactcagccgggccctccgctactactatgacaaaaacatcatgaccaaa
gtccacgggaagcgctacgcctacaagtttgacttccacggcatcgcccaggccctgcag
ccccaccctccagagtcttccctgtacaagtacccctcggacctcccttacatgggatcc
tatcacgcccacccacagaagatgaactttgtggccccccaccctccggccctacccgtg
acgtcgtccagtttttttgctgcccccaacccatactggaattcccccacaggaggcatc
taccccaacgctaggctcccagccagccacatgccttcgcatctgggcacttactactaa

DBGET integrated database retrieval system