KEGG   Camelus dromedarius (Arabian camel): 105105133
Entry
105105133         CDS       T04642                                 

Definition
(RefSeq) cytochrome P450 4F3
  KO
K17726  phylloquinone omega-hydroxylase / docosahexaenoic acid omega-hydroxylase / leukotriene-B4 20-monooxygenase [EC:1.14.14.78 1.14.14.79 1.14.14.94]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00590  Arachidonic acid metabolism
cdk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105105133
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105105133
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.78  phylloquinone omega-hydroxylase
     105105133
    1.14.14.79  docosahexaenoic acid omega-hydroxylase
     105105133
    1.14.14.94  leukotriene-B4 20-monooxygenase
     105105133
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP4 family
   105105133
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105105133
NCBI-ProteinID: XP_010997204
LinkDB
Position
22
AA seq 524 aa
MLQLSLTWLGLGPVAASLWLLLLLAAVSWLLARVLAWTYAFYDNVRRLRCFPQPPKRNWF
WGHLGLAKSNEEGLRLIEDLGHYFRDIHLWWMGPFYPILRLVHPNFVAPLLQAPATIVPK
DMFFYSFLKPWLGDGLLLSAGDKWSHHRRLLTPAFHFDILKPYVKIFNKSADIMHAKWQR
LASEGNTRLDMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYIAAILELSALMTKRTHQIF
LHMDFLYYLTPDGQRFRRACNLVHDFTNAIIQERRCTLTSQGSHDLLQAKAKAKTLDFID
VLLLAKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLAKHPEYQERCRQEVQE
LLRDREPKEIEWDDLTQLPFLTMCIKESLRLHPPVTVISRCCTQDVVLPDGRVIPKGNIC
VISIFGIHHNPSVWPDPEVYNPFRFDPETPLKRSPLAFIPFSAGPRNCIGQTFAMTEMKV
VLALTLLRFRVLPDEEEPRRLPELILRAEGGLWLRVEPLSAGAQ
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgctgcagctgagcctgacctggctgggtctcgggccggtggcagcctccctgtggctg
ctgctgctgctggccgcggtctcctggctcctggcccgcgtcctggcttggacctatgcc
ttctatgacaatgttcgccgcctccggtgtttcccgcagcccccgaaacggaactggttt
tggggtcacctgggtctggcgaagagcaatgaggagggcttgcgactgattgaagatctg
ggccactacttccgcgacatccacctctggtggatggggcccttctatcccatcctgcga
cttgtccaccctaacttcgttgcccctctgctccaggccccagccaccatcgtacccaag
gatatgtttttctacagcttcctgaagccctggctgggggatgggctcctgctgagtgcc
ggtgacaagtggagccaccatcgccgcctgctgacacctgccttccactttgacatcttg
aagccgtatgtgaagattttcaacaagagtgcagacatcatgcatgccaaatggcagcgc
ctggcctcagagggcaacactcgtctggacatgtttgaacacatcagcctcatgaccctg
gacagtctgcagaaatgtgtcttcagcttcgacagcaattgccaagagaaacccagcgaa
tatattgctgccatcttggagctcagtgcccttatgacaaaaaggacccaccagatcttc
ctgcacatggacttcctgtactacctcacccctgacgggcagcgcttccggagggcctgc
aacctggtgcacgacttcacaaatgccatcatccaggagcggcgctgcaccctcactagt
cagggttcccatgacttgcttcaggccaaggctaaggccaagactttggacttcattgat
gtgctcctgctggccaaggatgaagatgggaaggaactgtcagatgaggacatccgagcc
gaggctgacaccttcatgtttgagggccatgacaccacagccagcggcctctcctggatc
ctctacaaccttgcaaagcaccctgaataccaggagcgctgccggcaggaggtgcaagaa
ctcctgagggaccgtgagcctaaagagattgaatgggacgacctgacccagttgcctttc
ctgaccatgtgcatcaaggagagtctgcggttgcatcctccagtcacagtcatctctcgc
tgctgtacccaggacgttgtgctaccagatggccgggtcatccccaaagggaacatctgt
gtcatcagcatctttgggattcatcacaacccatcagtctggccagaccctgaggtatac
aatccctttcgctttgatccagaaacccccctgaagagatcacctctggcttttattccc
ttttcagcagggcccaggaactgcattgggcagacgtttgccatgactgagatgaaggtg
gtcctagcgctcacgctgctgcgcttccgtgtcctgccggatgaggaggagccgcgcagg
ttgccggagctgatcctacgcgcggagggcggactttggctgcgggtggagccactgagt
gcaggagctcagtga

DBGET integrated database retrieval system