KEGG   Camelus dromedarius (Arabian camel): 105105134
Entry
105105134         CDS       T04642                                 

Definition
(RefSeq) cytochrome P450 4F22
  KO
K17731  cytochrome P450 family 4 subfamily F polypeptide 22
Organism
cdk  Camelus dromedarius (Arabian camel)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cdk00199]
    105105134
Cytochrome P450 [BR:cdk00199]
 Cytochrome P450, animal type
  CYP4 family
   105105134
SSDB
Motif
Pfam: p450 TRAM_LAG1_CLN8
Other DBs
NCBI-GeneID: 105105134
NCBI-ProteinID: XP_010997205
LinkDB
Position
22
AA seq 531 aa
MLPITEHMLHLLGLEKTAFRLYAVTGLLLALLFFLFRLLLQFLGLCWRFYITCRRLRCFP
QPPRRNWLLGHLGMYLPNESGLQDENKVLESMHYVILVWLGPVLPLLVLVHPDYIKPLLG
ASAAVAPKDELFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQCTN
IMHAKWRRLVEGSDVSLDMFEHISLMTLDTLQKCVFSYNSDCQEKMSDYISAIIELSALV
VRRQYRLHHHLDFIYYRTADGRRFRQACDTVHHFTTEVIQKRRRVLRQQGMEAWLKAKQG
KTLDFIDVLLLARDEDGKEMSDEDIRAEADTFMFEGHDTTSSGLSWVFFNLAKYPEYQEK
CREEIQEVMKNRELEELEWEDLTQLPFTTMCIKESLRKFPPVTLISRQCTEDVKLPDGRI
IPKGIICLVSIYGTHYNPTVWPDAKVYNPYRFDPDNTEQRSPLAYMPFSAGPRNCIGQSF
AMAEMRVAVALTLLRFRLSVDPTRKVRRKPELILRTENGIWLKVEPLPPRA
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgctgcccatcacagagcacatgctgcacctcctgggattggagaagacggcgttccgc
ttgtatgccgtgaccgggctccttctcgccttgctcttcttcctcttccgtcttctgctg
cagttcctgggactctgctggcgcttctacatcacctgccgccggctgcgctgttttccc
cagccgccccggcgcaactggctactgggccacctgggcatgtatctcccaaatgagtcg
ggtctccaggatgagaataaggtgctggaaagcatgcactacgtgatcctggtgtggctg
ggacctgtcctgccactgttggttttagtgcaccctgactacatcaagcccctgctgggc
gcttcagctgctgttgctcccaaggatgaacttttctatggcttcctgaaaccttggctg
ggagatgggctgctgctcagcaaaggtgacaagtggagccgacaccgccgcctgctgaca
cctgccttccacttcgacatcctgaagccctacatgaagatcttcaaccagtgcaccaat
atcatgcatgctaaatggcggcgcctggtggagggctcggatgtctccctcgacatgttt
gagcacatcagcctcatgaccctggatactcttcagaaatgtgtcttcagctacaacagc
gactgccaggagaagatgagcgattacatctcggccatcattgagctgagtgctctggtg
gtccggcgccagtatcgcctgcaccaccacctcgacttcatctactaccgcacagcggac
gggcggcgtttccggcaggcctgtgacactgtgcaccacttcaccacggaggtcatccag
aagcggcggcgggtgctccgccaacagggcatggaagcctggcttaaggccaagcagggc
aagaccttggacttcatcgatgtgctgctcctggccagggatgaagatgggaaggaaatg
tcagacgaggacatccgagctgaagctgacaccttcatgtttgagggtcatgacacaaca
tccagcgggctctcatgggtgttcttcaacttggccaagtatccggagtaccaggagaag
tgccgggaagagatccaggaagtcatgaaaaatcgagagctagaggagctggagtgggag
gacctgacccagctgcccttcaccacaatgtgcatcaaggagagcctccggaagttccca
cccgtgaccctgatctcccgtcaatgcacagaggacgtcaagctcccagatgggcgtatc
atccccaaaggaatcatctgcctggtcagtatctacgggacccactataaccctacagtg
tggcctgacgccaaggtgtacaacccctatcgctttgacccggacaacacagagcagcgc
tccccgctggcttacatgcccttctctgcaggacccaggaactgcatcggacagagcttc
gccatggccgagatgcgcgtggccgtggcgctgacgctgctgcgtttccgcctgagcgtg
gacccaacgcgcaaggtgcgacggaagcccgagctcattctgcgcacggagaatggtatc
tggctcaaggttgagccactgcctccgcgggcctga

DBGET integrated database retrieval system