KEGG   Camelus dromedarius (Arabian camel): 105105973Help
Entry
105105973         CDS       T04642                                 

Gene name
TECR
Definition
(RefSeq) very-long-chain enoyl-CoA reductase
  KO
K10258  very-long-chain enoyl-CoA reductase [EC:1.3.1.93]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00062  Fatty acid elongation
cdk01040  Biosynthesis of unsaturated fatty acids
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
Module
cdk_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    105105973 (TECR)
   01040 Biosynthesis of unsaturated fatty acids
    105105973 (TECR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdk01004]
    105105973 (TECR)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.93  very-long-chain enoyl-CoA reductase
     105105973 (TECR)
Lipid biosynthesis proteins [BR:cdk01004]
 Fatty acid synthase
  Component type
   105105973 (TECR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh ubiquitin
Motif
Other DBs
NCBI-GeneID: 105105973
NCBI-ProteinID: XP_010998108
LinkDB All DBs
Position
22
AA seq 308 aa AA seqDB search
MKHYEVEILDAKTREKLCFLDKVEPQATIAEIKNLFTKSHPQWYPARQSLRLDPKGKSLK
DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGHKYDFT
SSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN
HPLYTPPTYGAQQVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTKNPFTWLF
LLVSCPNYTYEVGSWIGFAIMTQCLPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR
MPIIPFLL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattacgaggtggagattctggacgcaaagactcgggagaagctgtgcttcctg
gacaaggtggagccccaagccaccattgcagagatcaagaacctattcaccaagagccat
ccgcagtggtaccctgcccgccagtccctccgcctggaccccaagggcaagtccctgaag
gatgaggatgttctgcagaagctgcccgtgggcaccacggccacactctacttccgagac
ctgggggcccagatcagctgggtcacggtcttcctgacggagtatgcgggacccctcttt
atctacctgctcttctacttccgagtgcccttcatctacggccacaaatacgacttcacg
tccagtcggcacacagtggtgcacctcgcctgcatctgccactcattccactacatcaag
cgcctgctggagacactcttcgtgcaccgcttctcccacggcaccatgcccttgcgcaac
atcttcaagaactgcacctactactggggctttgctgcatggatggcctattacatcaac
caccctctctacacaccccccacctacggagctcagcaggttaaactggcactcgccatc
tttgtgatctgccagctcggcaacttctccatccacatggccctgcgggacctgcggcca
gctgggtccaagaccaggaagatcccataccccaccaagaaccccttcacatggctcttc
ctgctggtgtcctgccctaattacacctacgaggtggggtcctggattggctttgccatc
atgacacagtgtctcccagtggccctcttctccctggtgggcttcacccagatgactatc
tgggccaagggcaagcaccgcagctacctgaaggagttccgagattacccacccctgcgc
atgccaatcatacccttcctgctctga

DBGET integrated database retrieval system