KEGG   Camelus dromedarius (Arabian camel): 105105997Help
Entry
105105997         CDS       T04642                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9-like
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00512  Mucin type O-glycan biosynthesis
cdk01100  Metabolic pathways
Module
cdk_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    105105997
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cdk01003]
    105105997
Enzymes [BR:cdk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     105105997
Glycosyltransferases [BR:cdk01003]
 O-Glycan biosynthesis
  Mucin-type
   105105997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 105105997
NCBI-ProteinID: XP_010998134
LinkDB All DBs
Position
Un
AA seq 586 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRLQDRSEGLVQIVRSADRRVRSRHAKAGALAE
REAILQRLDHLEEVVYNQLNGLAKPIGLMEGPGGLGQGGMAATLHEDSQETERKYEEFGY
NAQLSDRISLDRTIPDYRPQKCRQMTYSDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SQLLKEVILVDDNSDNVELKLNLDQYVSKRYPGLVKIVRNSRREGLIRARLQGWKVAVAP
VVGFFDAHVEFSTGWAEPALTRIREDRRRIVLPAIDNIKYDTFEVQQYASAGLDRGDEAA
PIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENIELGMRVWQCGGSMEVLPCSRVAH
IERTKKPYNNDIDYYAKRNALRAAEVWMDGFKSHVYMAWNIPMTNPGVDFGDVSERLALR
QRLKCRSFKWYLDNVYPEMRTYNDTLTYGEVRNSKASGYCLDQGAEDDDRAILYPCHGMS
SQLVRYSAGGLLQLGPLGSTAFLPDSKCLVDDGRGRTPTLKKCEDVVRPAQRLWDFTQGG
PIVSRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWTIRNWIKPGRH
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccaggaagatcaaaactttgctgacggtcaacatcctggtgttcgtgggc
atcatcctcttttcggtgtactgccgcctgcaggaccgctcagaggggctggtgcagatt
gtgcgcagcgccgaccgccgggtgcgcagccggcacgccaaggcgggcgcgctggcggag
cgcgaagccatcctgcagcgcctggaccacctggaggaggtagtctacaaccaactgaat
ggcctcgccaagcccattggtctgatggaggggccgggcggcctgggccagggtggcatg
gcggccacgctgcatgaggacagccaggagacggagaggaagtacgaggaatttgggtac
aacgcacagctcagcgaccgcatctccctggacaggaccatccccgactacaggccccaa
aagtgcagacagatgacctactcggacgacctgccccagatctccgtggtgttcatcttt
gtcaacgaagccctctcggtcatcctgcgctccgtccacagcgtggtcaaccacacgccc
tcccagctcctcaaggaggtcatcctggtggacgacaatagcgataacgtggaactcaag
ctcaacctggaccagtacgtcagcaagaggtacccaggcctcgtgaagattgtccgcaac
agcaggcgggaaggcctgatccgggcgcggctacagggctggaaggttgccgtggcccct
gttgtcggcttctttgacgcccacgtggagttcagcacgggctgggccgagcccgccctc
acgcggatccgggaggaccgccggcgcatcgtcctgccggccatcgacaacatcaagtac
gacacgttcgaggtgcagcagtacgccagcgccgggctggaccgcggcgatgaggcggcg
cccatcaggaccccggccatgatcggctgctccttcgtggtggaccgggagtacttcggg
gacatcggcctgctggacccgggcatggaggtgtacggcggggagaacattgagctgggc
atgagggtgtggcagtgcggcggcagcatggaggtgctgccctgctcccgcgtggcccac
atcgagcgcaccaagaagccctacaacaacgacatcgactactacgccaagcgcaacgcc
ctgcgggctgccgaggtgtggatggacggcttcaagtcccacgtgtacatggcctggaac
atccccatgactaacccgggggtggacttcggggacgtgtctgagcggctggccctgcgc
cagaggctgaaatgccgcagcttcaagtggtacctggacaacgtgtacccagagatgagg
acctacaacgacacgctgacgtacggagaggtgagaaacagcaaagccagcggctactgc
ttggaccagggggcggaagatgatgaccgggccatcctgtacccctgccacgggatgtcc
tcccagctggtgcggtacagcgccggaggcctcctgcagctgggccccctgggctccacc
gccttcctgccggactccaagtgcctggtggatgacggcaggggccgcacgcccaccctg
aagaagtgtgaggacgtggtccggccggcgcagcggctgtgggacttcacccagggtggc
cccatcgtgagcagagacacgggccggtgcctggaggtggagatgtccaaggatgccaac
ttcgggctgcggctggtggtgcagaggtgctcggggcagaagtggacgatcagaaactgg
atcaagccgggtcggcactga

DBGET integrated database retrieval system