KEGG   Camelus dromedarius (Arabian camel): 105106261Help
Entry
105106261         CDS       T04642                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00052  Galactose metabolism
cdk00500  Starch and sucrose metabolism
cdk01100  Metabolic pathways
cdk04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105106261 (GAA)
   00500 Starch and sucrose metabolism
    105106261 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105106261 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105106261 (GAA)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105106261 (GAA)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105106261 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 105106261
NCBI-ProteinID: XP_010998403
LinkDB All DBs
Position
Un
AA seq 923 aa AA seqDB search
MRWPSCSHTLQGVCALASLVLLGHILLYSFAVAPRELCSFSRAPEEMYQARQLGASGLGP
RPAPGHQGSPRAAPTRCDLPPAGRFDCAPDKAITREQCEARXCYVPARQRPPGAQMGQPW
CFFPSGYPSYKLENLTTTETGYTATLTRTTPTFFPKDIMTLRLDVLMETESRLHLTIKDP
ANRRYEVPLETPRVHSRAPSTLYSVAFSEDPFGVVVRRKLDGRVLLNTTVAPLFFADQFL
QLSTSLPSQHITGLAEHLGPLMLSTNWTKVTLWNRDIAPVPDVNLYGSHPFYLVLEDDGS
AHGVFLLNSNAMDVVLQPSPALSWRSTGGILDLYVFLGPEPKNAVQQYLDIVGHPFMPPY
WGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDVDYMDARRDFTFNKDGFGDFPA
MVQELHQGGRRYMLIVDPAISSSSPAGTYRPYDEGLRRGVFITNETGQPLIGKVWPGLTA
FPDFTNPEALGWWQDMVGEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPNSDLENPPYVPG
VVGGTLRAATICASSQQFLSTHYNLHNLYGLTEAFASHRFAGHWTGDVWSSWEQLSYSVS
AILLFNLVGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNDLSSLPQEPYRFSE
TAQQAMRKALGLRYALLPHLYTLFHGAHVRGETVARPLFLEFPRDPRTWTVDHQLLWGEA
LLITPVLEAGKVEVTGYFPRGTWYDLQMVPVQAFGSHPLPPAAPLTSIIHSEGQWVMLPA
PLDTINLHVRAGHIIPMQGPGLTTTESRKQPMALAVALTPSGEARGELFWDDGESLGVLE
RGAYTQVIFLAGNNTVVNQLVRVSSEGASLQLRKVIVLGVAMAPQQVLCNGVPVSNFTYS
PDTETLDIPVSLMMGKQFLISWS
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggccgtcctgctcccacaccctgcagggggtctgcgcccttgcctccttggtc
ctcctggggcacatcctgctgtacagcttcgcagtggccccccgagagctgtgcagcttc
tcccgagcacccgaggagatgtaccaagctcgccagctgggagccagtggcctagggccc
cggcccgccccagggcaccaaggcagccccagggcagcgcccacacggtgtgacctgccc
cccgctggccgcttcgactgtgccccagacaaggccatcacccgggagcagtgcgaggcc
cggngctgctacgtgcccgcgaggcagcggcctcccggggcccagatggggcagccctgg
tgcttcttcccttccggctaccccagttacaagctggagaacctgaccaccacggagacg
ggctacacagccaccctgacgcgcaccaccccgaccttcttccccaaggacatcatgacc
ttacggctggatgtgctgatggagacggagagccggctccacctcacgatcaaagatccc
gccaacaggcgctacgaagtgcccttggagaccccgcgtgtccacagccgggcgccgtcc
acgctctacagtgtggcgttctcggaggacccctttggggtggtcgtgcggcggaagctg
gatggacgggtgctgctgaacaccaccgtggctcccctgttctttgccgaccagtttctg
cagctgtccacctccctgccatcccagcacatcacaggccttgccgaacacctcgggccc
ctgatgctcagcaccaactggaccaaggtcaccctctggaatcgggacatcgcccccgtg
cctgatgtgaacctgtacgggtcccaccctttctacctggtgctggaggacgacgggtca
gctcacggggtcttcctgctgaacagcaatgccatggacgtggtcctgcagccaagccca
gccctcagctggaggtcgacaggcgggattctggacttgtacgtcttcctgggcccggag
cccaagaacgcagtgcagcagtacctggacatcgtgggccacccgttcatgccgccgtac
tggggcctgggcttccacctgtgtcgctggggctactcctccaccgccatcacccgccag
gttgtggagaacatgaccagggcccatttccccctggacgtccagtggaacgacgtggac
tacatggacgccaggagggacttcactttcaacaaggacggcttcggggacttcccggcc
atggtgcaggagctccaccagggcggccggcggtacatgctgatcgtcgatcctgccatc
agcagctccagccccgccgggacctaccgcccctacgacgagggcctgcggcggggggtc
ttcatcaccaacgagaccgggcagcctctgattgggaaggtgtggcccggactcaccgcc
ttccccgacttcaccaaccccgaggccctaggctggtggcaggacatggtgggcgagttc
cacgcccaggtgcccttcgatggcatgtggattgacatgaacgagccatccaacttcgtg
aggggctctgtggacggctgccccaacagtgacctggagaacccgccctacgtgccaggg
gtggtcggcgggactctccgggcagccaccatctgcgcctccagccagcagttcctctcc
acgcactacaacctgcacaacctgtatggcctgaccgaggccttcgcctcccacagattc
gctggccactggacaggggacgtgtggagcagctgggagcagctctcctactccgtgtca
gccatcctgcttttcaatctggtgggggtgcccctggtgggggcggacgtctgcggcttc
ctgggcaacacctcggaggagctgtgcgtgcgctggacccagctgggggccttctacccc
ttcatgcggaaccacaacgacctcagcagcctgccgcaggagccgtacaggttcagcgag
acggcgcagcaagccatgaggaaggccttgggcctgcgctacgcgctcctgccccacctc
tacacgctgttccacggggcccacgtcaggggcgagaccgtggctcggcccctcttcctg
gagttccccagagacccccgcacctggaccgtggaccaccagctcctgtggggggaggct
ctgctcatcactccagtcctcgaggccgggaaggttgaggtcactggctacttcccccga
ggcacgtggtatgacctgcagatggtgccagttcaggcctttggcagccatccacttccg
cccgctgcacccctaacatccatcatccacagtgaggggcagtgggtgatgctacccgcc
ccactggacaccatcaacctccacgtccgggccggtcacatcatccccatgcagggccca
ggcctcacaaccacagagtcccgcaaacagcccatggccttggccgtggcactgaccccg
agcggggaggcccgaggggagctgttctgggacgacggggagagcctgggggtgctggag
cgcggggcttacacgcaggtcatctttctggctggaaacaacactgtcgtgaaccagttg
gtgcgtgtgagcagcgagggggccagcctgcagctgaggaaggtgatcgtccttggggtg
gccatggccccccagcaggtcctctgcaacggcgttcctgtctctaacttcacctacagc
cctgacactgagaccctggacatccctgtctcactgatgatgggaaagcagtttctcatc
agttggtcttaa

DBGET integrated database retrieval system