KEGG   Camelus dromedarius (Arabian camel): 105106395Help
Entry
105106395         CDS       T04642                                 

Gene name
LSP1
Definition
(RefSeq) lymphocyte-specific protein 1 isoform X1
  KO
K14957  lymphocyte-specific protein 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04625  C-type lectin receptor signaling pathway
cdk05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105106395 (LSP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105106395 (LSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 105106395
NCBI-ProteinID: XP_031304271
LinkDB All DBs
Position
Unknown
AA seq 424 aa AA seqDB search
MEKGGLPCGVDAALGARVSQLQGYRDQAAQPLGRASGPEPRALRFRPGSRPSPQTRVGQS
GKLTTQWSVEDEEEAARERRRRERDRQLRAQDEDEGDQSPEQLEQEKLLKPSEAPELDED
EGFGDWSQKPEQRQQLWGARENPDCGEPPRGESPERGQEQEDRFSLAQMQSRAGCQRLAS
PPPEPARPHQHVHGSQGDDELSPGGVCLEELRLSPSSEPQVGLGPEDTEPRGPEGPVQGS
PGLAETEEEDKQHQRCQQPRTPSPLVLEGTEPDSPPLSPSTKLIDRTESLNRSIEKSNSM
KKSQPALPISKIDERLEQYTQAVETAGRVPKLARQPSIELPSMAVASTKSRWETGEVQAQ
SAAKSPSCKDIVAGDMSKKSLWEQKGSSKTSSTVKSTPSGKRYKFVATGHGKYEKVLVDE
GPAP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggtggtctgccgtgcggggtggatgctgccctgggagcccgggtcagccag
ctgcaggggtacagggaccaagcggcccagcccctgggcagggcgtcggggccggagccc
agagcgctgaggttcaggccaggctccagacccagcccgcaaacccgagtaggacagagc
ggcaagctcaccactcagtggagcgtggaagatgaggaggaggccgcccgggagcggcgc
cgcagggagagggacaggcagcttcgggcccaggacgaggacgaaggggaccagtccccg
gagcagctggagcaggagaagctcctgaagccctcggaggcccctgaactggatgaagat
gagggtttcggcgactggtcccagaaaccagagcagcggcagcagctctggggggccagg
gagaaccctgactgcggagagccccctcggggcgagagtccggagcggggacaggagcag
gaggacaggttcagtctcgctcaaatgcagagccgcgcaggctgccagcggctggcctct
cctccccctgagccagcacgaccccaccagcacgtgcacgggagccagggcgatgatgag
ctgagcccaggcggggtctgtctggaggagctgcgtctgagccccagctcagagccccag
gtggggctgggaccagaggacacagagcccagaggccctgaggggcccgtccagggcagc
ccggggctggcggagactgaggaggaagacaagcagcaccagagatgtcagcagcccagg
acacccagccccttggtcttggaggggaccgaaccggactctcctcccctgagccccagc
accaaactcatcgacagaaccgagtccctgaaccgctccattgagaagagtaacagcatg
aagaagtcccagccagccctgcccatctccaagattgacgagcggctggagcagtacacc
caggccgtcgagactgccggccgggtccccaagctagcccgccagccctccatcgagctt
cccagcatggccgtggcaagcaccaagagtcggtgggagacgggagaggtgcaggctcag
tccgctgccaagtccccctcctgcaaggatattgttgctggagacatgagcaagaagagc
ctctgggagcagaagggaagctccaagacctcatcaacagttaagagcaccccgtctgga
aagagatacaagtttgtggccactggacacgggaagtacgagaaagtgcttgtggacgaa
ggcccggcgccctag

DBGET integrated database retrieval system