KEGG   Camelus dromedarius (Arabian camel): 105106603
Entry
105106603         CDS       T04642                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01523  Antifolate resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04064  NF-kappa B signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04380  Osteoclast differentiation
cdk04620  Toll-like receptor signaling pathway
cdk04621  NOD-like receptor signaling pathway
cdk04622  RIG-I-like receptor signaling pathway
cdk04623  Cytosolic DNA-sensing pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04657  IL-17 signaling pathway
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04668  TNF signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk05132  Salmonella infection
cdk05135  Yersinia infection
cdk05142  Chagas disease
cdk05145  Toxoplasmosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05212  Pancreatic cancer
cdk05215  Prostate cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05222  Small cell lung cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05340  Primary immunodeficiency
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105106603 (IKBKG)
   04014 Ras signaling pathway
    105106603 (IKBKG)
   04064 NF-kappa B signaling pathway
    105106603 (IKBKG)
   04668 TNF signaling pathway
    105106603 (IKBKG)
   04151 PI3K-Akt signaling pathway
    105106603 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105106603 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105106603 (IKBKG)
   04621 NOD-like receptor signaling pathway
    105106603 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    105106603 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    105106603 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    105106603 (IKBKG)
   04660 T cell receptor signaling pathway
    105106603 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    105106603 (IKBKG)
   04659 Th17 cell differentiation
    105106603 (IKBKG)
   04657 IL-17 signaling pathway
    105106603 (IKBKG)
   04662 B cell receptor signaling pathway
    105106603 (IKBKG)
   04062 Chemokine signaling pathway
    105106603 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105106603 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105106603 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105106603 (IKBKG)
   05203 Viral carcinogenesis
    105106603 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105106603 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105106603 (IKBKG)
   05221 Acute myeloid leukemia
    105106603 (IKBKG)
   05220 Chronic myeloid leukemia
    105106603 (IKBKG)
   05215 Prostate cancer
    105106603 (IKBKG)
   05222 Small cell lung cancer
    105106603 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    105106603 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105106603 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105106603 (IKBKG)
   05135 Yersinia infection
    105106603 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105106603 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    105106603 (IKBKG)
   05162 Measles
    105106603 (IKBKG)
   05164 Influenza A
    105106603 (IKBKG)
   05161 Hepatitis B
    105106603 (IKBKG)
   05160 Hepatitis C
    105106603 (IKBKG)
   05168 Herpes simplex virus 1 infection
    105106603 (IKBKG)
   05163 Human cytomegalovirus infection
    105106603 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105106603 (IKBKG)
   05169 Epstein-Barr virus infection
    105106603 (IKBKG)
   05165 Human papillomavirus infection
    105106603 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105106603 (IKBKG)
   05142 Chagas disease
    105106603 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    105106603 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105106603 (IKBKG)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   105106603 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1
Other DBs
NCBI-GeneID: 105106603
NCBI-ProteinID: XP_031302174
LinkDB
Position
X
AA seq 419 aa
MSRPPWKSQPSEMVQPSSGPAGDPDVLAEESSLGKPAMLHLPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRLQGSQREEKEFLMQKFQEARKLVERLSLEKVDLRRQKEQ
ALHEVERLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAAAKERQALESRARAASEQ
ARQLESEREALQQRHSVQVDQLRMQNQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSGAVSSERSRGSQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMRKRH
VEVSQAPLAPASTHHSFQLALPSQRRSPPEEPLNFCCPKCQYQAPDIDTLQIHVMECID
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggccgccctggaagagtcagccgagtgagatggtgcagcctagcagcggccca
gcaggggacccagacgtgctggctgaagagtcttctctggggaagccggccatgctccac
ctgccttcagagcagggcaccccggagaccttccagcgctgtctggaggagaatcaagag
ctccgagatgctatcaggcagagcaaccagatgctgcgggagcgctgtgaggagctgcag
cgtctgcagggcagccagcgggaggagaaggaattcctcatgcagaagttccaggaggcc
aggaagctggtggagagactgagcctggagaaggtggacctgcgccggcagaaggagcag
gccctgcatgaggtggagcgcctgaagcggtgccaacagcagatggccgaggacaaggcc
tcagtgaaggcgcaggtgacgtccctgctgggggagctccaggagagccagagtcgcctg
gaggccgccgccaaggagcggcaggctctggagagcagggcccgggcagccagcgagcag
gcccggcaactggagagtgagcgggaggcgctgcagcagcggcacagcgtgcaggtggac
cagctgcgcatgcagaaccagagcatggaggccgccctgcgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagctgcaggtggcctatcaccagctcttccaggag
tacgacagccacatcaagagcggcgcggtgagcagcgagcggagcagaggatcgcagctg
gaagatctcaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaattg
atcgacaaactgaaggaagaggctgagcagcacaagatcgtgatggagacagttccagtc
ctgaaagcccaggcggatatctacaaggcggacttccaggctgagaggcaggcccgggag
aagctggctgagaagaaggagttcctgcaggagcagctggagcagctgcagagggagtac
agcaggttaaagaccagctgccaggaatcggccaggattgaagacatgaggaagcgacac
gtagaggtctcccaggcccccttagcccctgcctcgactcaccactcctttcaactggcc
ctgcccagccagaggagaagcccccctgaggagccactcaacttctgttgccccaagtgc
cagtatcaggcccctgacatagacaccctgcagatacacgtcatggagtgcatcgactag

DBGET integrated database retrieval system