KEGG   Camelus dromedarius (Arabian camel): 105106649
Entry
105106649         CDS       T04642                                 

Gene name
PRXL2B
Definition
(RefSeq) prostamide/prostaglandin F synthase
  KO
K15717  prostamide/prostaglandin F2alpha synthase [EC:1.11.1.20]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00590  Arachidonic acid metabolism
cdk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105106649 (PRXL2B)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.20  prostamide/prostaglandin F2alpha synthase
     105106649 (PRXL2B)
SSDB
Motif
Pfam: AhpC-TSA_2 AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 105106649
NCBI-ProteinID: XP_031319721
LinkDB
Position
13
AA seq 201 aa
MSTVDLARVGACVLKHAVTGEAVELRSLWQEQACVVAGLRRFGCMVCRWIARDLSSLKGL
LEQHGVRLVGVGPEALGLQEFLDGGYFAGELYLDESKQFYKELGFKRYNSLSILPAALGK
PVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVAKGGDKVLLHFVQKSPGDYAPQETILQAL
GISAEACTSEPPQCDEEACSR
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagcacggtggaccttgcccgcgtgggcgcatgtgtcctgaagcacgcggtgaccggg
gaggccgtggagctgcggagcctgtggcaggagcaggcgtgcgtggtggccggcttgcgg
cgcttcggctgcatggtgtgtcgctggatcgctcgggacctcagcagcctcaaggggctc
ctggagcagcacggcgtgcgcctggtgggcgtggggcccgaggccctgggcctgcaggaa
ttcctggacggtggctacttcgctggagagctctacctggatgagagcaagcagttttac
aaggagctgggcttcaagcggtacaacagcctgagcatcctgccggccgccctggggaag
cccgttcgtgacgtggccgccaaggccaaggctgttggcatccaggggaatctgtctggg
gatctgctgcagagcggagggctgctggtggttgccaaaggtggtgacaaagtcctgcta
cactttgtccagaagtccccaggtgactacgccccccaggagaccatcttgcaggccctg
ggcatctctgcagaggcctgcaccagcgagccaccccagtgcgacgaagaagcgtgctcg
aggtga

DBGET integrated database retrieval system