KEGG   Camelus dromedarius (Arabian camel): 105107024
Entry
105107024         CDS       T04642                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04012  ErbB signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04136  Autophagy - other
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04371  Apelin signaling pathway
cdk04613  Neutrophil extracellular trap formation
cdk04630  JAK-STAT signaling pathway
cdk04659  Th17 cell differentiation
cdk04714  Thermogenesis
cdk04910  Insulin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04930  Type II diabetes mellitus
cdk04931  Insulin resistance
cdk04935  Growth hormone synthesis, secretion and action
cdk05010  Alzheimer disease
cdk05014  Amyotrophic lateral sclerosis
cdk05016  Huntington disease
cdk05017  Spinocerebellar ataxia
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05221  Acute myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105107024 (MTOR)
   04371 Apelin signaling pathway
    105107024 (MTOR)
   04630 JAK-STAT signaling pathway
    105107024 (MTOR)
   04066 HIF-1 signaling pathway
    105107024 (MTOR)
   04072 Phospholipase D signaling pathway
    105107024 (MTOR)
   04151 PI3K-Akt signaling pathway
    105107024 (MTOR)
   04152 AMPK signaling pathway
    105107024 (MTOR)
   04150 mTOR signaling pathway
    105107024 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105107024 (MTOR)
   04136 Autophagy - other
    105107024 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    105107024 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    105107024 (MTOR)
   04659 Th17 cell differentiation
    105107024 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105107024 (MTOR)
   04920 Adipocytokine signaling pathway
    105107024 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    105107024 (MTOR)
   04919 Thyroid hormone signaling pathway
    105107024 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    105107024 (MTOR)
   04213 Longevity regulating pathway - multiple species
    105107024 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    105107024 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105107024 (MTOR)
   05206 MicroRNAs in cancer
    105107024 (MTOR)
   05205 Proteoglycans in cancer
    105107024 (MTOR)
   05230 Central carbon metabolism in cancer
    105107024 (MTOR)
   05231 Choline metabolism in cancer
    105107024 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105107024 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105107024 (MTOR)
   05212 Pancreatic cancer
    105107024 (MTOR)
   05225 Hepatocellular carcinoma
    105107024 (MTOR)
   05226 Gastric cancer
    105107024 (MTOR)
   05214 Glioma
    105107024 (MTOR)
   05221 Acute myeloid leukemia
    105107024 (MTOR)
   05215 Prostate cancer
    105107024 (MTOR)
   05224 Breast cancer
    105107024 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105107024 (MTOR)
   05014 Amyotrophic lateral sclerosis
    105107024 (MTOR)
   05016 Huntington disease
    105107024 (MTOR)
   05017 Spinocerebellar ataxia
    105107024 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    105107024 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105107024 (MTOR)
   04931 Insulin resistance
    105107024 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105107024 (MTOR)
   05168 Herpes simplex virus 1 infection
    105107024 (MTOR)
   05163 Human cytomegalovirus infection
    105107024 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105107024 (MTOR)
   05165 Human papillomavirus infection
    105107024 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105107024 (MTOR)
   01522 Endocrine resistance
    105107024 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105107024 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105107024 (MTOR)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105107024 (MTOR)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   105107024 (MTOR)
Membrane trafficking [BR:cdk04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    105107024 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 105107024
NCBI-ProteinID: XP_031319911
LinkDB
Position
13
AA seq 2550 aa
MLGTGPAAATTATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDNFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANVTNTAAAATTAATATATATSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccacagctaccaccacgtccagcaacgtgagc
gttctgcagcagttcgccagtggcctgaagagccggaatgaggagaccagggccaaagca
gccaaggagctccagcactatgtcaccatggagctgcgcgagatgagtcaagaggagtct
actcgcttctatgatcaactgaaccatcacatttttgaactagtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggcggaaat
gccacccgaatcggaagatttgctaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcgtccaaagccatcggccgccttgccatggcgggggacaatttt
accgctgagtatgtggagtttgaggtgaaacgagcactggaatggctgggtgctgaccgc
aacgagggccggagacatgcagctgtcctggttctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaatatttttgtggctgtgtgggac
cccaaacaggccatccgcgagggagctgttgccgcccttcgtgcctgtctgatcctcacc
acccagcgtgagccgaaggagatgcagaagccgcagtggtaccggcacacgtttgaagaa
gcagagaaagggtttgatgagaccttggccaaggagaagggcatgaaccgggatgatcgg
atccatggagccctgctgatcctcaacgagctggtccgaatcagcagcatggagggagag
cgcctgagagaagaaatggaggaaatcacacagcagcagttggtacatgacaagtactgc
aaagatctcatgggctttggaacgaaacctcgtcacatcacccccttcaccagtttccag
gccgtgcagccccagcagtcaaacgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttggggcttcccccagcccagcgaagtccaccctggtggagagtcgc
tgttgccgagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcactgatccaaatgacgatccttaatttgttgccccgcttggct
gccttccgaccttctgccttcacagatacccagtacctccaagatacgatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcagcctttcaggccctggggctactc
tctgtggccgtgaggtctgagtttaaggtctatttacctcgtgtgctggacatcatccga
gcagccctgccccctaaggattttgcccacaagagacagaaagcgatgcaggtggatgcc
actgtgttcacctgcatcagcatgctggcccgagcaatggggccaggcatccagcaggac
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcacagctgtg
ctgtacgacctgagccgtcagattccacagctgaaaaaggacatccaggatgggctcctg
aagatgctgtccctggtcctaatgcacaaacccctccggcacccaggcatgcccaagggc
ctggcgcatcagctggcctcccctggcctcacaaccctccctgaggccagcgacgtgggc
agcattactcttgccctccgaactcttggcagttttgaatttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcatttcctgaacagcgagcacaaggagatccgcatg
gaagccgcccgcacctgctcccgcctgctcacgccctccgtgcacctcatcagcggccat
gcccacgtggttagccagactgcagtgcaagtggtggcagatgtgctcagcaaactgctc
gtggtggggataacagatcctgaccctgacatccgctactgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggcagagaatttgcaggccctgtttgtggccctg
aatgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagcagc
atgaacccagccttcgtcatgcccttcctacgcaagatgctcatccagattctgacagag
ctggagcatagcggcattggaagaatcaaggaacagagcgcccgcatgctggggcacctg
gtctccaatgccccccgactcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagatcctgatccaaacccaggtgtgatcaataatgtcttggct
acaataggagagttggctcaggttagtggcctagaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaggactcctctctgttggccaaaagacaggtggct
ctgtggaccctgggacagctggtggccagcactggctatgtggtggagccctacaggaag
taccccacgttgcttgaggtgctactgaacttcctgaagactgagcagaaccaggggaca
cggcgagaggcgatccgtgtgttagggcttttgggggccctggatccctataagcacaaa
gtcaacatcggcatgatcgaccagtcccgggacgcttctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactacagcaccagtgaaatgctggtcaacatggggaac
ctgcctctggacgagttttacccggccgtgtccatggtggccctgatgcggatcttccga
gaccagtccctctctcaccatcacaccatggtcgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagtttttgccccaggtcatgcccacgttcctgaatgtc
attcgcgtttgtgacggggccatccgggaatttctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctccatccagagcaccatcattcttctcattgagcaaattgtg
gtagctcttggcggtgaatttaaactctacctgccccagctgatcccgcacatgctacga
gtcttcatgcatgacaacagtccaggccgcatcgtctccatcaagttgctggctgcaatc
cagctgtttggcgccaacctggatgactacttgcatttgttactgccccctatcgtgaag
ttgtttgatgcccctgaagttccactgccatctcgaaaggcagcattagagacagtggac
cgcctgacggagtccctggatttcactgactatgcctctcggatcattcacccgattgtt
cgaacactggaccagagcccagagcttcgttccacagccatggacacattgtcttcactc
gtttttcaactggggaagaagtaccaaattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaaccatcagcgctatgatgtcctcatctgcagaattgtcaagggatac
acccttgctgatgaagaagaggaccctttgatttaccagcatcgaatgctgaggagtggc
caaggggatgcattggctagtggcccagtagaaacgggacccatgaagaaattgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaggacgactgg
ttggagtggctgaggcggctgagcctggagctgctgaaggactcctcgtcaccctccctg
cgctcgtgctgggccttagctcaggcctacaaccccatggccagggatctcttcaacgct
gcgttcgtgtcctgctggtcggagctgaatgaagaccagcaggatgagctcatcagaagc
atcgagttggccctcacctcacaggacatcgctgaagtcacacagactctcttaaacttg
gctgaattcatggaacacagtgacaagggcccgctgccactgagagatgacaatggcatt
gttctgctgggtgagagggctgccaagtgccgagcatatgccaaagcgctacactacaaa
gaactggagttccagaaaggccccacccccgccatcctagagtctctcatcagcattaat
aataagctacagcagccagaggcagctgccggggtattggaatatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcatgagtgggaggatgctctt
gtggcctacgacaagaagatggacaccaacaaggatgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatgggggcaactccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagagtacacctgtatgatccctcgggacacc
cacgatggggcattttatagagccgtgctggcgctgcatcaggacctcttctccttggca
caacagtgcatcgacaaagcccgggacctgctggacgctgagttaactgcgatggctgga
gagagctacagtcgggcatacggggccatggtttcttgccatatgctgtctgagctggaa
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactacagggctgccagcgtattgtggaggactggcagaaaatccttatggtgcgg
tcgcttgtggtcagcccgcacgaggacatgaggacctggctcaagtacgcaagcctgtgt
ggcaagagtggcagactggctcttgctcacaaaaccttggtgctgctcctgggagttgat
ccgtctcggcaacttgaccatcctttgccaacagttcaccctcaggtgacctacgcctac
atgaaaaatatgtggaagagcgctcgcaagatcgatgccttccagcacatgcagcacttt
gttcagaccatgcagcagcaagcccagcatgccatcgctaccgaggaccagcagcacaag
caggagctgcacaagctcatggcccgatgtttcctgaaactgggggagtggcagctgaac
ctgcagggcatcaatgagagcacgatccccaaggtcctgcagtactacagcgccgccacg
gagcatgaccgcagctggtacaaggcctggcacgcgtgggcagtgatgaacttcgaagct
gtgctgcactacaaacatcaaaaccaggcccgtgacgagaagaagaagctgcggcacgcc
agcggggccaatgtcaccaacacggccgccgccgccaccaccgcagccaccgccaccgcc
acggccaccagcacagagggcagcaacagcgagagcgaggccgagagcactgagaacagc
cccaccccatctcccctgcagaagaaggtcaccgaggatttgtccaaaaccctcttgatg
tacaccgtccctgccgtccagggcttctttcgttccatctctttgtcacgaggcaacaac
ctccaggacacgctcagagtcctcaccttatggtttgattacggtcactggccggatgta
aatgaagccttagtggaaggggtgaaagcaatccagattgacacttggttacaggttata
cctcagctcattgcaagaatcgatacgccaaggcccttggtgggacgtctcattcaccag
cttctcacagacattggtcggtaccacccccaggccctcatctaccccctgaccgtggct
tccaagtccaccaccacagcccgtcacaacgcagccaataagattctgaagaacatgtgt
gagcacagtaacaccttggtgcagcaggccatgatggtgagcgaggagctgatccgagtg
gccatcctctggcacgagatgtggcacgaaggcctggaggaagcgtctcggctgtacttc
ggggagaggaacgtgaagggcatgttcgaggtgctggagcccctgcacgccatgatggag
cgggggccccagactctgaaggagacgtccttcaaccaggcgtatggtcgagatttaatg
gaggcccaggagtggtgcaggaagtacatgaagtcagggaacgtaaaggacctcacccag
gcctgggatctctactaccatgtgttcagacgcatctctaagcagctgcctcagctcacg
tccttagagctgcagtacgtgtccccaaagcttctgatgtgccgggaccttgaactggct
gtgccaggaacgtatgaccccaaccagcccatcatccgcattcagtccatcgcaccttct
ttgcaagtcatcacatccaagcagagaccccggaagttgacacttatgggcagcaacggg
cacgagtttgttttcctcctgaagggccacgaagacctgcggcaggacgaacgagtcatg
cagctcttcggcctggtcaacacccttctggccaacgacccaacgtctcttcgtaaaaac
ctcagtatccagagatatgctgtcattcccttatcaaccaactcggggctcatcggctgg
gttccccactgtgacacgctgcacgccctcatccgggactaccgggagaaaaagaagatc
cttctcaacattgagcatcgcatcatgctgcggatggctccggactacgaccacctgacc
ctgatgcagaaggtcgaggtgttcgagcacgccgtcaacaacacagccggggacgacctg
gccaagctgctgtggctgaaaagccccagctccgaggtgtggtttgatcgaagaaccaat
tatacccgttctttagcagtcatgtccatggttgggtatattttgggcctgggcgatagg
cacccctccaatctgatgctggaccggctgagcgggaagatcctgcacattgactttggg
gactgctttgaggttgctatgaccagagagaaattcccagagaagattccatttagacta
acgagaatgctgaccaatgctatggaggtcaccggtctggacggcaactacagaatcacg
tgccacacggtgatggaagtgcttcgggagcacaaggacagtgtcatggccgtgctggaa
gcctttgtctatgaccccttgctcaactggaggctgatggacacaaataccaaaggcaac
aagcgatctcgaacaaggacagattcctactctgctggccagtcagtagaaattttggac
ggtgtggaacttggggaaccagcccataagaaaacggggaccacagtgccagaatctatt
cattctttcattggagacggtttggtgaaaccagaggccctaaataagaaagctattcag
attattaacagggttcgagataagctcactggtcgggacttctctcacgatgaaaccttg
gatgtcccaacacaagttgagctgctgatcaaacaagcaacatcccatgaaaacctctgc
cagtgctacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system