KEGG   Camelus dromedarius (Arabian camel): 105107056
Entry
105107056         CDS       T04642                                 

Gene name
CASP9
Definition
(RefSeq) LOW QUALITY PROTEIN: caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01524  Platinum drug resistance
cdk04115  p53 signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04215  Apoptosis - multiple species
cdk04370  VEGF signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk05010  Alzheimer disease
cdk05012  Parkinson disease
cdk05014  Amyotrophic lateral sclerosis
cdk05016  Huntington disease
cdk05020  Prion disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05134  Legionellosis
cdk05145  Toxoplasmosis
cdk05152  Tuberculosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05215  Prostate cancer
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    105107056 (CASP9)
   04151 PI3K-Akt signaling pathway
    105107056 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105107056 (CASP9)
   04215 Apoptosis - multiple species
    105107056 (CASP9)
   04115 p53 signaling pathway
    105107056 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    105107056 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105107056 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105107056 (CASP9)
   05212 Pancreatic cancer
    105107056 (CASP9)
   05215 Prostate cancer
    105107056 (CASP9)
   05213 Endometrial cancer
    105107056 (CASP9)
   05222 Small cell lung cancer
    105107056 (CASP9)
   05223 Non-small cell lung cancer
    105107056 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105107056 (CASP9)
   05012 Parkinson disease
    105107056 (CASP9)
   05014 Amyotrophic lateral sclerosis
    105107056 (CASP9)
   05016 Huntington disease
    105107056 (CASP9)
   05020 Prion disease
    105107056 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    105107056 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    105107056 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    105107056 (CASP9)
   05152 Tuberculosis
    105107056 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105107056 (CASP9)
   05161 Hepatitis B
    105107056 (CASP9)
   05160 Hepatitis C
    105107056 (CASP9)
   05164 Influenza A
    105107056 (CASP9)
   05162 Measles
    105107056 (CASP9)
   05168 Herpes simplex virus 1 infection
    105107056 (CASP9)
   05163 Human cytomegalovirus infection
    105107056 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105107056 (CASP9)
   05169 Epstein-Barr virus infection
    105107056 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105107056 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105107056 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105107056 (CASP9)
   01002 Peptidases and inhibitors [BR:cdk01002]
    105107056 (CASP9)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     105107056 (CASP9)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105107056 (CASP9)
Peptidases and inhibitors [BR:cdk01002]
 Cysteine peptidases
  Family C14: caspase family
   105107056 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 105107056
NCBI-ProteinID: XP_010999180
LinkDB
Position
13
AA seq 452 aa
MNEADRQVLRRYXLRLVSELQVASLWXALLNRELFTPDMIEEIQRAGSGSRRDQARQLIT
DLETRGSQALSLFISCLEDTGQNMLASLLRTSSQAARQHPEAIRPLDLKPVVLRPEGLKP
ESLGVGKQDPLMPTPGKLVPVVLGPKELWPAKLRPEVLRPEVPRPVDIGSGGLSDVCAQD
RAKGNANLAYVLSADPCGRCLIVNNVHFRRESGLRTRTGSSVDCERLQRRFHLLHFVVEV
ECDLTAKQMVQALVELAQRDHSALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVERI
VNIFNGTGCPSLRGKPKLFFIQACGGEQKDHGFEVASTFPEGQTPDSDPEPDATPFQEGP
GTVDQPDAMSSLPTPSDILVSYSTFPGFVSWRDTKSGSWYIETLDSVFEQWAHCEDLQTL
LLRVANAVSVKGIYKQIPGCFNFLRKKLFFKT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgaacgaggctgaccggcaggtcctgcgacggtacnggttgcggctggtgagcgagttg
caggtggcctcgctctggnacgctttgctgaaccgcgagctcttcacccccgacatgata
gaggaaatccagcgggcaggctctgggtctcggcgtgatcaggccaggcagctgatcaca
gatctagagactcgagggagtcaggccctttctttgttcatctcctgcttggaggacaca
ggtcagaacatgttggcttcattactgagaaccagtagtcaagcggcaaggcagcatccg
gaggccatcagacccctggatcttaagcctgtggtgctgaggccagagggcctcaaacca
gagtcgctgggagtgggtaagcaggatccattgatgccaaccccaggaaaactcgttcca
gtggtgctggggccgaaggagctctggccggccaagctcagacctgaggttctcagacca
gaggtgcccaggccagtggacattggttctggaggactcagtgatgtctgtgctcaggac
agagccaagggaaatgccaatttggcctatgtcctgagcgcggacccctgtggccgctgc
ctcattgtcaacaacgtgcacttccgccgtgagtcggggctcaggacccgcaccggctcc
agtgtggactgtgagaggctgcagcggcggttccacttgctgcacttcgtggtggaggtg
gagtgtgacctcacggccaagcaaatggtccaggctttggtggagctggcacagcgggac
cacagcgctctggactgctgcgtggtggtcatcctttcccatggctgtcaggccagccac
ctccagttcccaggggctgtttatggcacagatggatgtcctgtgtccgtcgagaggatt
gtgaacatcttcaatgggactggctgtcccagcctgagagggaagcccaagctcttcttc
atccaggcctgtggtggagagcagaaagatcatgggtttgaggtggcctccactttccct
gaaggccagactcctgacagtgaccccgagccagacgctaccccgttccaggaaggcccg
ggcaccgtggaccagccggacgccatgtctagtttgccaacacctagcgacatcctggtg
tcctactccaccttcccaggttttgtctcctggagggacaccaagagtggctcctggtac
atcgagaccctggacagtgtttttgagcagtgggcccactgtgaggacctgcagactctc
ctgctcagggttgctaatgctgtttcggtgaaagggatttacaaacagattcctggctgt
tttaatttcctccggaaaaaacttttctttaaaacgtaa

DBGET integrated database retrieval system