KEGG   Camelus dromedarius (Arabian camel): 105107079Help
Entry
105107079         CDS       T04642                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00020  Citrate cycle (TCA cycle)
cdk00190  Oxidative phosphorylation
cdk01100  Metabolic pathways
cdk01200  Carbon metabolism
cdk04714  Thermogenesis
cdk04932  Non-alcoholic fatty liver disease (NAFLD)
cdk05010  Alzheimer's disease
cdk05012  Parkinson's disease
cdk05016  Huntington's disease
Module
cdk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cdk_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105107079 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    105107079 (SDHB)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    105107079 (SDHB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    105107079 (SDHB)
   05012 Parkinson's disease
    105107079 (SDHB)
   05016 Huntington's disease
    105107079 (SDHB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105107079 (SDHB)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105107079 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 105107079
NCBI-ProteinID: XP_010999209
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAVVAFSLRRRFPATTLGGACLQACRRAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcgttctccttgaggcgccggttcccggccacaaccctcggcggg
gcctgcctgcaggcttgccgcagggcccagacagctgcagccacagctccccgaatcaag
aaatttgccatctaccgatgggacccagacaagactggagataaacctcatatgcaaact
tacgaaattgatttgaataactgtggccctatggtattggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcgtgcagagaaggtatctgcggctct
tgtgcgatgaacatcaacggaggcaacactctagcttgcacccgaagaattgacaccaac
ctcaacaaagtttcaaaaatctaccctctcccacatatgtatgtgataaaggatcttgtg
cctgatttgagcaacttctacgctcagtacaaatccattgagccttacctaaagaagaag
gacgagtcccaggaaggcaagcagcagtacctgcagtccatagaagatcgggagaaactg
gacgggctgtacgagtgcatcctgtgcgcctgctgcagcaccagctgccccagctactgg
tggaacggcgacaagtacctgggacccgcggtgctcatgcaggcctatcgctggatgatc
gactcccgggacgacttcacagaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacgaagacctgtcccaaggggctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggccacctataaggagaagaaagcctcagct
taa

DBGET integrated database retrieval system