KEGG   Camelus dromedarius (Arabian camel): 105107130Help
Entry
105107130         CDS       T04642                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor isoform X1
  KO
K05062  leptin receptor
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04060  Cytokine-cytokine receptor interaction
cdk04080  Neuroactive ligand-receptor interaction
cdk04152  AMPK signaling pathway
cdk04630  Jak-STAT signaling pathway
cdk04920  Adipocytokine signaling pathway
cdk04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    105107130 (LEPR)
   04152 AMPK signaling pathway
    105107130 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105107130 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    105107130 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105107130 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105107130 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cdk04050]
    105107130 (LEPR)
   04090 CD molecules [BR:cdk04090]
    105107130 (LEPR)
Cytokine receptors [BR:cdk04050]
 Interleukin receptor families
  Prolactin receptor family
   105107130 (LEPR)
CD molecules [BR:cdk04090]
 Proteins
  105107130 (LEPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Motif
Other DBs
NCBI-GeneID: 105107130
NCBI-ProteinID: XP_031321178
LinkDB All DBs
Position
13
AA seq 895 aa AA seqDB search
MICQKFYVALLHWEFIYGITAFNLAYPISPWKFKLSCMPPNTTYDFLLPAGLSKNTSNLN
GHYEAVVETKLNSSGTYLSNLPSKTTFHCCFWSEEDKNCSVCADDVEGKAFVSTANSLVF
QQIGANWNIQCWMKEDLKLLICYMEPLFKNPLKNYDLKVHLLYVLLEVLEESPRPSQKDS
FQIVQCNCSVHECCECHVPVPTAKLNYTLLMYLKITSGGVTFHSPPMSVQPINVVKPDPP
SGLHMEITDTGDLKISWSSPISVPFQLRYQVKYSENSTTNMRKADETVSATSLLVDSALP
GSSYEVQVRGKRLDGPGIWSDWSTPLTFTTQDVIYFPPKILTSVGSNVSFHCVYKNENKI
VSSKKIVWWMNLAEKIPQSQYDVVGDHVSKVTFPNLNATRPRGKFTYDAVYCCNEHECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSTNAIQSLVGSALQLRYHRSSLYCSDVPSIH
PISEPKDCHLQRDGFYECIFQPIFLLSGYTMWIRINHPLGSLDSPPTCVVPDSVVKPLPP
SSVTAEITVKIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKLKSASLPV
PDVCAIYAVQVRCQRLDGLGYWSDWSTPAYTAVTDIQVPLRGPEFWRIINEDITKKERNV
TLFWKPLMKTDSLCSVRRYVVKHYTSRIGTWSEDVGNHTKFTFPWTEQTHSVTVLAINSI
GASSANFNLTFSLSMSKVNIVQSLSAYPLNSSCVILSWMLSPSDYNLTYFILEWTILNED
NEIKWLRIPSSVKKYYIHDHFIPIEKYQFSLYPVFMEGVGKPKIINSFTQGDEKHQNDAG
LYVIVPIIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKRMDIL
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtcaaaaattctatgtggctttgttacattgggagtttatttatgggataact
gcatttaacttggcatatccaattagtccctggaaatttaagttgtcttgcatgccaccg
aatacaacatatgacttcctcttgcctgctggactctcaaagaacacttcaaatttgaat
ggacattatgaggcagttgttgaaactaaacttaattcaagtggtacctacttatctaac
ttaccatccaaaacaacttttcactgttgcttttggagcgaggaagataaaaactgctct
gtatgtgcagacgacgttgaagggaaagcatttgtttcaacagcaaattctttagttttt
caacaaataggtgcaaactggaacatacagtgctggatgaaagaggacttgaaattattg
atctgttatatggagccattatttaagaatcctttaaagaattatgaccttaaggtccat
cttttatatgttctgcttgaagtgttggaagagtcacctcggccctcccagaaagacagt
tttcagattgttcagtgcaactgcagtgttcacgaatgttgtgaatgccatgtgcctgtg
ccaacagccaaactcaattacacccttcttatgtatttgaagatcacatctggtggagta
acttttcactcacctccaatgtcagttcagcccataaatgtcgtgaagcctgatccacca
tcaggtttgcatatggaaatcacggacactggtgatttaaagatttcttggtccagccca
atatcagtaccatttcaacttcggtatcaagtgaaatattcagagaattctacaacaaat
atgagaaaagctgatgagactgtctcagctacttctctgctagtagacagtgcgctccct
gggtcttcctatgaggttcaggtgaggggcaagagactggatggcccaggaatctggagt
gactggagtacaccgcttacctttaccacacaagatgtcatatacttcccacctaaaatt
ctgacaagtgttgggtctaacgtttcttttcactgcgtctataaaaatgaaaacaagatt
gtttcctcaaaaaagattgtttggtggatgaatttagctgagaaaattcctcaaagccag
tatgatgttgtgggtgaccatgttagcaaagttacttttcccaatctgaatgcaaccaga
cctcgagggaagttcacctatgacgcagtgtactgctgcaatgagcacgagtgccaccat
cgctatgctgaattatatgtgattgatgtcaatatcaatatatcatgtgaaactgatggg
tacttaactaaaatgacttgcagatggtcaactaatgcaatccaatcacttgtgggaagt
gctttgcagctgaggtatcataggagcagcctttactgttctgatgttccatctattcat
cccatatctgaacccaaagactgccacttgcagagagatggtttttatgaatgcatattt
cagccaatctttctgttatccggctatacaatgtggattagaattaatcacccgttgggt
tcacttgactcgccaccgacgtgtgtcgttcctgattccgtggtgaaaccactgcctcca
tccagtgtgacagcagaaattactgtaaaaattggattattgaaaatatcttgggaaaag
ccagtctttccagagaataatcttcagtttcagattcgctatggtttaagtggaaaagaa
gtacaatggaagatgtatgaggtgtatgatgcaaaattaaaatccgccagtctccccgtg
ccagacgtgtgtgccatctatgctgtccaggtgcgctgtcagaggctggatggactgggg
tattggagtgattggagcactccggcctacaccgctgttacagatatacaagttcctctc
agaggaccggaattttggagaataattaatgaagacatcactaaaaaagagagaaatgtc
actttgttttggaagcccctgatgaaaactgactcattgtgcagtgtgagaagatatgtg
gtgaaacattatacttcccgcatcggaacgtggtcagaagacgtggggaatcacactaaa
ttcactttcccatggacagagcaaacgcattctgttacagttctggccatcaattcaatt
ggtgcttcttctgcaaattttaacttaacattctcattgtcgatgagtaaagtaaatatc
gtgcagtcactcagtgcttatcctttaaacagcagttgtgtgattctttcctggatgctg
tcacccagtgattacaatctgacgtattttattctcgagtggacaattcttaatgaagac
aatgaaattaagtggcttagaatcccttcctctgttaagaagtattatatccatgatcac
tttatccccattgagaagtatcagtttagtctttacccagtatttatggaaggagtgggg
aaaccgaagataattaatagttttacccaaggtgacgaaaaacaccagaatgatgcaggt
ctatatgtaattgtgccaataattatttcctcttccatcttgttgcttggaacattgtta
atatcacaccaaaggatgaaaaagctgttttgggaagatgttccaaaccccaagaactgt
tcctgggcacaaggacttaattttcagaagagaatggatattctttga

DBGET integrated database retrieval system