KEGG   Camelus dromedarius (Arabian camel): 116149897
Entry
116149897         CDS       T04642                                 

Gene name
NKX3-1
Definition
(RefSeq) LOW QUALITY PROTEIN: homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk05200  Pathways in cancer
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116149897 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    116149897 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    116149897 (NKX3-1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    116149897 (NKX3-1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 116149897
NCBI-ProteinID: XP_031298060
LinkDB
Position
31
AA seq 243 aa
MLRAPEPRPAEAGAAGGQNPAAPPAPSKPLTSFLIQDILRDGAERHGGPAGNPRPQPPRQ
PDPRRDPAQESEEGRGGAGAPEDQPSARLRAARREAEPPAETEADRHLGTYLLDCENTPG
TLPSRPQTPRQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIW
FQNRRYKTKRKQLTSDLGDLEKQASLPARKEEGFSRASLISVHNTYPYYPYLYCLGGWSP
ALW
NT seq 732 nt   +upstreamnt  +downstreamnt
atgctccgggctcccgagccacggccagcggaggcaggcgcggccggcgggcagaacccg
gccgcgccaccagccccgtccaagccgctcacctccttcctcatccaggacatcctgcgg
gacggcgcggagcggcacggaggcccagcgggcaacccgcggccgcagcccccgcgccag
ccggacccgaggcgagaccctgcgcaggagtccgaagaaggaaggggcggcgccggggcg
cccgaggaccagccgagcgcccggctccgcgccgcgcggagggaggccgagccgccggcg
gagactgaggcagataggcacttggggacttatctgttggactgtgaaaacactccgggc
accttaccgagccggccccagacccccaggcagccgcagaagcgctcccgagccgccttc
tcccacactcaggtcattgagttagagaggaagttcagccaccagaagtacctgtcagcc
cctgaaagggctcacctggccaagaacctcaagctcacagagacccaagtgaaaatatgg
ttccagaacagacgctacaagaccaagcggaagcagctcacctcggacctgggggacctg
gagaaacaagcctccttaccagctcggaaagaggaaggcttctcgcgggcctccctcatc
tctgtgcataacacctacccttactacccctacctttactgcttgggaggctggagccca
gctctctggtaa

DBGET integrated database retrieval system