KEGG   Cronobacter dublinensis: AFK67_01870Help
Entry
AFK67_01870       CDS       T04061                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00061  Fatty acid biosynthesis
cdm00620  Pyruvate metabolism
cdm00640  Propanoate metabolism
cdm01100  Metabolic pathways
cdm01110  Biosynthesis of secondary metabolites
cdm01120  Microbial metabolism in diverse environments
cdm01130  Biosynthesis of antibiotics
cdm01200  Carbon metabolism
cdm01212  Fatty acid metabolism
Module
cdm_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK67_01870
   00640 Propanoate metabolism
    AFK67_01870
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AFK67_01870
Enzymes [BR:cdm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     AFK67_01870
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     AFK67_01870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ALB65284
UniProt: A0A0K2NXM2
LinkDB All DBs
Position
complement(399289..400638)
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIIAAAEITGAVAIHPGYGFLSENANFAEQVEQSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLGDDMDKNRAHAKRIGYPVIIKASGGGGGRGMRVVRSDAELAQ
SISMTKAEAKAAFNNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVVVKGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVALARMRNALQELIIDGIKTNVDL
QTRIMNDENFQHGGTNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaaattgtcatcgctaaccgtggcgaaatcgcactgcgtattcttcgtgcc
tgcaaagagctgggcatcaagaccgtcgcggtgcattcgaccgcggatcgcgatctgaaa
cacgtactgctggcagacgagaccgtgtgcatcggtccggcgccgtcagtcaaaagctat
ctgaacatcccggcgattatcgctgctgccgaaattaccggcgcggtcgctatccacccg
ggttacggcttcctgtccgagaacgccaactttgccgagcaggttgagcaatccggcttt
atcttcatcggcccgaaagccgacaccattcgcctgatgggcgataaagtctccgcgatc
accgcgatgaagaaagcgggcgtaccgaccgtacctggctccgacggcccgctgggcgac
gatatggataagaaccgcgcccatgcgaaacgcattggctacccggttattatcaaagcg
tctggcggcggcggcggtcgcggtatgcgcgttgtgcgcagcgacgccgaactggcgcag
tccatctccatgaccaaagcggaagcgaaagccgcgttcaacaacgacatggtctacatg
gagaagtacctggaaaatccgcgccacatcgaaattcaggtgctggcggatggtcagggc
aacgctatctatctggcagagcgcgactgctccatgcagcgtcgtcaccagaaagtggtc
gaagaagcgccggcaccgggcattaccccggaactgcgccgctacatcggcgagcgctgc
gcgaaagcctgtgtggatatcggctatcgcggcgcgggtacgttcgagttcctgtttgaa
aacggcgagttctactttatcgagatgaacacccgtattcaggtagagcatccggttacc
gagatgattacaggcgttgaccttatcaaagagcagctgcgtatcgctgccggtcagcca
ctctctatcaaacaggaagaagtcgtggtcaaaggccatgcggtggaatgccgtatcaac
gccgaagacccgaacaccttcctgccaagcccgggtaaaatcacgcgcttccacgcgccg
ggcggttttggcgttcgctgggaatcgcacatttacgccggttataccgtaccgccgtat
tacgattccatgattggcaagctcatctgctacggtgaaaaccgcgatgtggcgctggcc
cgtatgcgtaacgccctgcaggagctgatcatcgacggcatcaaaaccaacgttgatctg
cagacccgcatcatgaacgatgaaaacttccagcacggtgggacgaacatccactacctg
gagaagaaactgggcctgcaagagaaataa

DBGET integrated database retrieval system