KEGG   Cronobacter dublinensis: AFK67_02885Help
Entry
AFK67_02885       CDS       T04061                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cdm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AFK67_02885
Enzymes [BR:cdm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AFK67_02885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase DUF4434 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: ALB65470
UniProt: A0A0K2NY72
LinkDB All DBs
Position
614943..617003
Genome map
AA seq 686 aa AA seqDB search
MNKFAPLSPKVSALLHGADYNPEQWEHYPGTVESDIAMMQQAKCNVMSVGIFSWAKLEPE
EGVFRFEWLDEIIDKLYQGGIHVFLATPSGARPAWMSQKYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTATINRLLAERYAHHPAVLGWHISNEYGGECHCDLCQENFRGWLKARYG
TLDKLNEAWWSTFWSHTFTDWSQIESPAPQGENSIHGLNLDWRRFNTAQVTDFCRHELAP
LKAVNPELPATTNFMEYFYDYDYWQLAEPLDFISWDSYPMWHREKDETELACYTAMYHDL
MRTLKHGKPFVLMESTPGTTNWQPTSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVAQLGDILSQLDPVVGARVDAQVAVIFDWESRWAMDDA
QGPRNLGLEYEKTVAEHYRPFWEQGIAVDIINADADLSRYKLVIAPMLYMVREGFAQRVE
AFVEQGGHFVTTYWSGIVNDTDLCHLGGFPGPLRKLLGIWAEEIDCLADGERNLIQGLAG
NEAGLQGPYQVRHLCDLIHTEGATALATYRDDFYAGRAAVTVNGFGAGKAWYVASRNDLA
FQRDFFANIINELALARALEADFPPGVTAHARQDGESAFIFVENYTGAPQSVLLPEGCAD
MLTGDAVSGKLPLAPWGCRILRRRLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttgcgcctttaagtccgaaggtcagcgcccttttgcacggcgcggactac
aacccggagcagtgggagcactatccgggcaccgttgagagcgatatcgccatgatgcag
caggccaaatgcaacgtcatgtcggtcggtattttcagctgggcgaagcttgagcccgaa
gagggcgtgttccgcttcgagtggctcgatgagattatcgacaagctgtatcagggcggc
attcacgtgtttctcgcgacgccgagcggcgcgcgcccggcctggatgtcgcagaaatac
ccccaggtgctgcgcgtggggcgcgatcgcgttccggcgctgcacggcgggcgtcacaat
cactgcatgagctcgccggtctaccgcgaaaaaaccgcgaccattaaccgtctgctggcg
gagcgttacgcgcaccacccggcggtgctcggctggcacatctctaatgaatatggcggc
gagtgtcattgcgatttatgtcaggagaatttccgcggctggctgaaagcgcgctacggc
acgctcgataaactcaacgaggcctggtggagcaccttctggagccacacgtttaccgac
tggtcgcagattgagtccccggcgccgcagggcgaaaactctattcacggcctgaatctg
gactggcggcgcttcaacaccgcgcaggtgaccgatttctgccgtcacgaactggccccg
ctgaaggcggtgaacccggaattaccggcgaccactaacttcatggagtatttctacgat
tacgactactggcagctcgcggagccgctcgattttatctcctgggacagctacccgatg
tggcaccgcgagaaagacgaaaccgagcttgcctgctacacggccatgtatcacgacctg
atgcgcactttaaagcacggcaaaccgtttgtgctgatggaatcgacgccgggcaccacc
aactggcagcccaccagcaagctgaaaaagccggggatgcatattctctcctcgctccag
gcggtggcgcacggcgcggatgcggtgcagtacttccagtggcgcaagagccgcggctcg
gtggagaaattccacggcgcggtggtcgatcacgtcggccatatcgacacccgcatcggg
cgcgaagtggcgcagctcggcgatatcttaagccagctcgacccggtggtcggcgcgcgg
gtggacgcgcaggtggcggtgattttcgactgggaaagccgctgggcgatggatgatgcg
cagggcccgcgtaacctggggctggagtatgagaagaccgtcgccgagcactaccggcct
ttctgggagcaggggatcgcggtcgatatcatcaacgccgacgccgatctcagccgctat
aaactggttatcgcgccgatgctctacatggtgcgcgagggcttcgcacagcgcgtcgag
gcgttcgtcgaacagggcggtcacttcgtgacgacgtactggagcggcatcgttaatgac
accgatctctgccatctgggcgggttccccggcccgctgcgtaagctgctgggcatctgg
gcggaagagattgactgcctcgcggacggcgaacgcaacctcattcaggggctggcgggc
aacgaagcggggctacaggggccgtatcaggtacgccatctgtgcgatcttatccacacc
gaaggcgcgacggcgctcgcgacctatcgcgacgacttctacgccggacgcgcggcggtg
accgttaacgggtttggcgcgggcaaggcgtggtatgtcgcctcgcgtaacgatctcgcc
ttccagcgtgatttcttcgccaacattattaacgagctggcgcttgcgcgcgcgctggag
gcggacttcccgccaggcgtcacggcgcacgcccgtcaggatggcgaatcggcgtttatc
ttcgttgaaaactacaccggcgcgccgcagtcggtgctgctgccggagggctgcgcggat
atgctgaccggcgatgccgtcagcggcaagctgccgctcgccccgtgggggtgccgcatt
ctgcgccgccgcctcgcctga

DBGET integrated database retrieval system