KEGG   Cronobacter dublinensis: AFK67_03620Help
Entry
AFK67_03620       CDS       T04061                                 

Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00550  Peptidoglycan biosynthesis
cdm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFK67_03620
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AFK67_03620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdm01011]
    AFK67_03620
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdm03036]
    AFK67_03620
Enzymes [BR:cdm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AFK67_03620
Peptidoglycan biosynthesis and degradation proteins [BR:cdm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AFK67_03620
Chromosome and associated proteins [BR:cdm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    AFK67_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: ALB65610
UniProt: A0A0K2NYL0
LinkDB All DBs
Position
786382..788148
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTLKPKRQEEQANFISWRFALLCGCIFLALAFLLARVAWLQIVDPDMLVRQGDMR
SLRVQEVSTARGMITDRSGRPLAVSVPVKAIWADPKELHDAGGITLDNRWKALSDALKIP
LDQLSARVNANPKGRFIYLARQVNPDIGDYIKKLKLPGIHLREESRRYYPSGAVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNITGTPKDVMRNRTIT
DVFEPGSTVKPMVVMTALQRGVVQENTVLNTVPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKSTNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGVYRPLSITKVDPPVPGERIFPESIVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASNPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALTTGEKSEFVINREEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagcaaagacgcttaaaccaaaacgtcaggaagaacaggccaactttatt
agttggcgttttgcgttgctttgcggctgcatctttttggcgctggcctttctcctggcg
cgcgtcgcctggctgcaaattgtcgacccggatatgctggtgcgccagggcgatatgcgt
tcactgcgcgtgcaggaagtatccaccgcgcgcggcatgataaccgaccgctccgggcgt
ccgctggcggtgagcgtgccggtaaaagccatctgggccgatccgaaagaactgcacgac
gctggcggcatcacgcttgataaccgctggaaggcgctctccgacgcgctcaaaattccg
ctcgatcagctttccgctcgcgtcaacgctaacccgaaaggccgctttatctatctggcg
cgtcaggtaaacccggatatcggcgactacatcaaaaagctcaagctgcctggcatccat
ctgcgtgaagaatcacgccgttactacccttcaggcgcagtgaccgctcacctcatcggc
tttaccaacgttgacagccagggcatcgaaggcgtcgaaaaaagcttcgataaatggctt
accggccagcccggcgagcgtatcgtgcgtaaagaccgctatggccgtgtaattgaggat
atctcctccaccgacagccaggcggcgcataacctggcgttaagcatcgacgaacgcctt
caggcgctggtctaccgcgaacttaataacgccgtggcgtttaacaaggcggaatccggc
agcgcggtgctggtggatgtgaacactggcgaagtgctggcgatggccaacagcccctcc
tacaacccgaacaacatcaccggcacgccgaaagacgtcatgcgtaaccgcacgatcacc
gatgtcttcgagcctggttctaccgtaaaaccgatggtggtgatgacggcgctgcagcgc
ggcgtggtgcaggaaaatacggtgctcaataccgttccttatcggatcaacggtcatgaa
atcaaagacgtcgcccgctacagcgagctgacgcttaccggggttttacagaagtcgagt
aacgtcggggtttccaaactggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttggactcggcaagtccacgaatcttgggctggtcggagaacgcagtggctta
tatccacaaaaacaacggtggtctgacatagagagggccaccttctcattcggctacggg
ctaatggtaacgccgttacagttagcgcgagtctacgcgacgattggcagctacggcgtc
tatcgcccgctgtctatcacgaaagtcgacccgccggttcctggcgagcgcatcttcccg
gaatccatcgtgcgtaccgtggtgcacatgatggaaagcgtggcgttgccgggcggcggc
ggcgtgaaggcggccattaagggctaccgcattgcgattaaaaccggtacggcgaaaaaa
gtcgggccggacggacgatacatcaacaaatacattgcttacaccgcaggcgttgcacct
gccagcaatccgcgtttcgcgctggtggtggtgattaacgatccgcaggcgggcaaatac
tacggcggcgccgtttccgcgccggtctttggtgccatcatgggcggcgttctgcgcacc
atgaacatcgaaccggacgcgctgacaacgggcgaaaaaagtgaattcgtaattaatcga
gaagagggaacaggtggcagatcgtaa

DBGET integrated database retrieval system