KEGG   Cronobacter dublinensis: AFK67_03660Help
Entry
AFK67_03660       CDS       T04061                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00473  D-Alanine metabolism
cdm00550  Peptidoglycan biosynthesis
cdm01100  Metabolic pathways
cdm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFK67_03660 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFK67_03660 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AFK67_03660 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdm01011]
    AFK67_03660 (ddl)
Enzymes [BR:cdm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AFK67_03660 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:cdm01011]
 Precursor biosynthesis
  Amino acid ligase
   AFK67_03660 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_Ter TTL Csa1
Motif
Other DBs
NCBI-ProteinID: ALB65618
UniProt: A0A0K2NYQ2
LinkDB All DBs
Position
797208..798128
Genome map
AA seq 306 aa AA seqDB search
MAEKIAVLLGGSSAEREVSLQSGSAVLAGLKEAGVDAYAIDPRDVCVTTLKEEGFDKVFI
ALHGRGGEDGTLQGTLDYLGLPYTGSGVMASAITMDKRRTKLLWQGAGLPVASWVALERR
DIASGLSETLTARIAALGLPVIVKPSREGSSVGMSKVDSAEALLPALELAFEHDSEVLVE
KWLSGPEFTVAILGDEILPSIRIQPAGVFYDYEAKYLSDETQYFCPSGIDADREQALQAL
VLEAWRVLGCQGWGRVDVMQDSDGEFYLLEVNTAPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaaatcgccgtactgctgggcggcagctcagcggagcgtgaggtttccctg
caatcgggcagcgccgtgctggcggggctcaaagaggcgggcgtcgatgcgtatgccatc
gacccgcgcgacgtgtgcgtcacgacgctgaaagaagaagggttcgataaagttttcatc
gcgctgcatggtcgcggcggcgaagacggtacgctccagggtacgctggactatctcggc
ctgccttataccggcagcggcgtaatggcctcggccatcacgatggataagcggcgcacc
aaactgctctggcagggtgccgggctgccggtcgcgtcgtgggtggcgctggagcgtcgc
gatatcgcaagcggcctgagcgaaacgctgacagcgcgtatcgccgcgctgggcctgccg
gttatcgtgaagccgagccgtgagggctcaagcgtcggcatgtcgaaagtcgacagtgcc
gaagcgctgttgcccgcgcttgaactggcgttcgagcatgacagcgaggtgttggtagag
aaatggctgagcggcccggagtttaccgtggctatcctgggcgatgaaatattgccctct
attcgcattcagcctgccggcgtgttttacgactatgaggcgaaatacctctcggacgag
acgcagtatttctgcccgagcggcattgatgccgaccgcgagcaggcgctgcaggcgctg
gtgctggaggcctggcgcgtgctgggttgtcagggctggggccgcgtggacgtgatgcag
gacagcgacggcgagttctacctgcttgaggtgaacacggcgcctggcatgaccagccat
agtctggtgccgatggcggcgcgacaggcgggcatgagcttctcgcagctggtggtgcgt
attctggagctggcggactga

DBGET integrated database retrieval system