KEGG   Cronobacter dublinensis: AFK67_04755Help
Entry
AFK67_04755       CDS       T04061                                 

Definition
(GenBank) beta-lactam-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
cdm  Cronobacter dublinensis
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdm01002]
    AFK67_04755
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdm01011]
    AFK67_04755
Enzymes [BR:cdm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AFK67_04755
   3.4.21  Serine endopeptidases
    3.4.21.-  
     AFK67_04755
Peptidases and inhibitors [BR:cdm01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   AFK67_04755
Peptidoglycan biosynthesis and degradation proteins [BR:cdm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AFK67_04755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11 pPIWI_RE_X
Motif
Other DBs
NCBI-ProteinID: ALB65817
UniProt: A0A0K2NZW5
LinkDB All DBs
Position
complement(1038006..1039163)
Genome map
AA seq 385 aa AA seqDB search
MKRCLLSCALLISAAFPAAQAAQTSPDPIFASDIVDRYANHIFYGSGATGMAIVVIDGNQ
RVFRSFGETRPGNNVRPQLDSVIRIASLTKLMTSEMLVKMLDQGVVKLDDPLSRYAPSGA
RVPTYQGEPIRLVNLATHTSALPREQPGGAAKRPVFVWPTRQQRWEWLSTATLKAAPGAT
AAYSNLAFDLLADALANAAGKPYTQLFEEQITRPLGMKDTTFTPSPDQCKRLMVAEKGAS
PCNNTLAAIGSGGVYSTPDDMMRWMQQFLASDFHRRSAQADRMQTLIYQRTQLTRVVGMD
VPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGFITYMAMVPQSNIGAFVVVTRSPLTRF
TNMSDGINDLVTELSGNKPLSTPES
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgttgtctgctctcctgcgccctgctgattagcgcagcctttcctgcggcccag
gccgcgcaaacctcgccggacccgatctttgcgtccgatatcgtcgaccgttacgccaac
catattttctacggcagcggcgcgaccggcatggcgatcgtggtgattgacggtaaccag
cgcgtgttccgaagcttcggcgaaacgcgccccggcaataacgttcgcccgcagctcgac
tcggttatccgtatcgcctcgctcaccaaactgatgaccagcgaaatgctggtgaaaatg
ctcgatcagggcgtggtgaagcttgacgatccgctgagccgttacgcgccgtccggcgcg
cgcgtgccgacgtatcagggcgagcctatccggctggtgaatctcgccacgcataccagc
gccttgccccgcgagcagccgggcggcgcggcgaaacgcccggtgttcgtctggccgacg
cgtcagcagcgctgggagtggctctccaccgcgacgttaaaagcagcgcctggcgcgacg
gcggcctattccaatctcgcctttgacctgctggccgacgcgctggcgaacgccgcaggt
aagccttacacccagctgtttgaagagcagataacccgtccgctcggcatgaaagacacc
acgtttacgccctcgccggatcagtgcaagcgcctgatggtggccgaaaaaggcgccagc
ccgtgcaataacacgctggcggcgattggcagcggcggggtctactccacgccggacgac
atgatgcgctggatgcagcagttcctggcgtccgattttcaccgccgcagcgcgcaggcc
gaccggatgcagacgctgatttatcagcgcacgcagctgacccgcgtggtgggtatggac
gtgccgggcaaggccgacgcgctcgggcttggctgggtctatatggctccgaaagacggc
cgccccggcatcatccagaaaaccggcggcggcggcggtttcatcacttacatggcgatg
gtgccgcagagcaatatcggcgcgttcgtggtggtaacccgttcgccgctcacccgcttt
accaacatgagcgacggcatcaacgatctggtgaccgaactgagcggcaacaaaccgctc
tcaacgccggaatcgtaa

DBGET integrated database retrieval system