KEGG   Cronobacter dublinensis: AFK67_05875Help
Entry
AFK67_05875       CDS       T04061                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cdm  Cronobacter dublinensis
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AFK67_05875
Enzymes [BR:cdm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AFK67_05875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Thi4 FAD_binding_3 DAO NAD_binding_8 AlaDh_PNT_C K_oxygenase Glutaredoxin FMO-like LpxI_N
Motif
Other DBs
NCBI-ProteinID: ALB66026
UniProt: A0A0K2NZW2
LinkDB All DBs
Position
1288484..1290049
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLERLTKPVELVATLDDSAKSAEIKELLTEIAELSDKVSFREDNSLAA
RKPSFLITNPGSTQGPSFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGAVFQNEITERNVMGVPAVFMNGVE
FGSGRMTLAEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSATKLIPAATEG
GLHQIQTASGAVLKARSVIVATGAKWRNMGVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPDMKADQVLQDKLRSLKNVDIILNAMTTEVKGD
GTRLTGLDYQDRVTGSVKHLEVAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaacatgaaaacccagctcaaggcctatcttgagcgtctgacaaaacct
gttgagttagtggccacgctggatgacagcgcgaaatcagcagagatcaaagaactgctg
acggaaatcgctgagctgtctgacaaagtctctttccgggaagacaacagcctcgcagcg
cgtaaaccttcatttttaatcaccaacccaggctctactcagggtccgagctttgcgggt
tcgccgctcggccacgagttcacctcgctggtgctggcgctgctctggaccggcggtcat
ccgtcgaaagaagcgcagtcgctgcttgagcagatccgcgatctggatggcgattttgag
ttcgaaacctactactcgctctcctgccacaactgcccggatgtcgtgcaggcgctgaac
ctgatggcggtactgaacccgcgcatcaagcacacggctattgatggcgcggtgttccag
aatgaaatcaccgagcgcaatgtgatgggtgttccggcagtctttatgaacggcgtggag
tttggctctggccgtatgacccttgcggaaatcgtggcgaaagtggacaccggcgcggaa
aaacgcgcggcggaagagctgaaccagcgtgacgcctacgacgtgctgattgtcggctcc
ggcccggcgggcgcggcggcggcggtatactccgcgcgtaaaggcattcgtaccggcctg
atgggtgagcgtttcggcggccaggtgctcgacaccgtggatatcgaaaactacatctcc
gtgccgaaaaccgaaggccagaaactggcgggcgcgctgaaagcgcacgtggacgactac
gatgtagacgttatcgacacccagagcgcgacgaagcttatcccggcggcgaccgaaggc
ggcctgcatcagatccaaaccgcctccggcgcggtgctgaaagcgcgcagcgtgatcgtg
gcgaccggcgcgaaatggcgcaacatgggcgtgccgggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaaacgcgtggcggtg
atcggcggcggtaactccggcgtggaagcggcgattgatcttgcgggtatcgttgagcac
gtgaccctgctggagttcgcacctgacatgaaagccgaccaggtattgcaggataaactg
cgcagcctgaaaaacgtcgacatcattctgaacgcgatgactaccgaagtgaaaggcgac
ggcacgaggctgaccggtctggattaccaggatcgcgtcaccggctccgtgaagcatctg
gaagtggcagggatcttcgtgcagattggtctgctgccgaacaccacctggcttgaaggc
gctatcgagcgtaaccgcatgggcgaaattatcatcgacgccaaatgcgaaaccagcgtg
aaaggcgtattcgcggccggcgactgcaccaccgtgccgtacaaacagattatcatcgcc
accggcgaaggcgcgaaagcgtcgctgagcgcctttgattatctgattcgcaccaaaacc
gcgtaa

DBGET integrated database retrieval system