KEGG   Cronobacter dublinensis: AFK67_06780Help
Entry
AFK67_06780       CDS       T04061                                 

Definition
(GenBank) EmrA
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
cdm  Cronobacter dublinensis
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdm02000]
    AFK67_06780
Transporters [BR:cdm02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   AFK67_06780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 Biotin_lipoyl_2 HlyD_3 HlyD Biotin_lipoyl HlyD_2 DUF4448 PTS_EIIA_1 Orf78
Motif
Other DBs
NCBI-ProteinID: ALB66194
UniProt: A0A0K2P067
LinkDB All DBs
Position
1476919..1478064
Genome map
AA seq 381 aa AA seqDB search
MAENHNNNADEEKRQEQGDDTSKGKDNGKAQGETRKRPGKKPLIILGVVVIIMVIGALIW
WLMTRNLETTDDAFIEGDAVTVAPKVAGYVTELRVKDNQRVKKGDLLVVIDPRDATAQRD
QARAQLSLAQSQLHQAQAQLALARVQYPAQRDQAKAQVLRAEAELANARAEYQRQRGVDP
RATSKQNIDAASAQLRSAEAGLANAKAQLEVAEQVQLQIRQQETNVEARESQVAQARAQL
QTAELNLSYTEVRAPFDGFVTKRNVQNGTLVQAGSALFSLVSPEIWVVANFKESQLERMR
PGDKVAVSVDAFPDLELEGHVESIQQGSGSRFSAFPAENATGNFVKIVQRVPVKIVIDKG
LEHWDQPLPLGLSVEPEVTVE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatcacaataacaacgctgacgaagagaaacgtcaggagcagggcgacgat
accagcaaaggcaaggataacggcaaggcgcaaggtgaaacgcgcaagcgccccggcaag
aaaccgctgattattctcggcgtcgtggtcattattatggtaattggcgcccttatctgg
tggctgatgacccgcaatcttgaaaccaccgacgatgcctttattgaaggcgatgccgtc
accgtcgcgccgaaagtggcaggctacgttaccgaactgcgcgttaaagataaccagcgg
gtgaaaaaaggcgacctgctggtggttatcgacccgcgtgacgccaccgcccagcgcgac
caggcccgcgcgcagctgtcactcgcgcagtcgcaattgcatcaggcgcaggcgcagctg
gcgcttgccagagtgcagtatccggcccagcgcgatcaggcgaaagcgcaggtgctgcgc
gccgaggcggagcttgccaacgcgcgcgccgaatatcagcgccagcgcggcgttgaccct
cgcgccacctcaaaacaaaacatcgacgccgccagcgcccagctgcgcagcgccgaggcg
gggcttgccaatgcgaaagcgcagctggaagtcgccgaacaggtgcagctgcaaatccgt
cagcaggaaaccaacgtcgaggcccgcgaaagccaggtggcccaggcgcgcgcgcagtta
cagacggccgagctgaacctttcctataccgaagtccgcgcgccgtttgacggcttcgtc
accaaacgcaacgtccagaacggcacgctggtgcaggcgggcagcgcgctcttctcgctg
gtgtcgcccgagatttgggtggtggcgaacttcaaagagtcgcagcttgagcgtatgcgc
cctggcgataaagtcgcggtttccgtagacgccttcccggatctcgaactcgaaggccat
gtggagagcattcagcagggcagcggttcgcgcttctcggcgtttccggcggaaaacgcc
accggcaactttgtgaaaatcgtccagcgcgtgccggtgaaaatcgtcatcgataaagga
cttgagcattgggaccagccgctgccgctcgggctgtcggtcgagcctgaggtgacggtg
gaatga

DBGET integrated database retrieval system