KEGG   Cronobacter dublinensis: AFK67_09220Help
Entry
AFK67_09220       CDS       T04061                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00480  Glutathione metabolism
cdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFK67_09220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdm02000]
    AFK67_09220
Enzymes [BR:cdm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AFK67_09220
Transporters [BR:cdm02000]
 Other transporters
  Pores ion channels [TC:1]
   AFK67_09220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ALB68821
UniProt: A0A0K2P7W3
LinkDB All DBs
Position
complement(2020357..2020965)
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIILREADIDFTLVAVDLAAKRTENGEDYLTINPKGQVPALLLDDG
TLLTEGVAIVQYIADLVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPGTPDE
YKTIAREQLQKKFEYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQAFDNIAD
YQARVKARPAVAAALKAEGLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttttacaaagccggcgcgtgttcgctttcgccgcatatcattctgcgcgaa
gccgatatcgattttacgctggtggcggtggatcttgccgcgaaacgcacggagaacggc
gaggactacctgaccatcaacccgaaaggccaggtgccagcgctgctgctggatgacggt
acgctgctgacggaaggcgtcgctatcgttcagtacatcgccgatcttgtgccggaccgc
cagctgctcgcgccggtgggcagcatgacccgctaccatacgctggagtggctcaactat
atcgccaccgagctgcataaaggctttaccccgctgttccgtccgggtacgccggatgag
tacaaaactatcgcccgcgagcagctgcagaagaaatttgagtatgtaaacgaggcgctg
gcgcagaaacagtggctgatggggctgcgcttcagcgtggcggacgcctacctgtttacg
gtgctgaactgggcgaaagcggtcgggcttgagatgcaggcgtttgacaatatcgccgac
taccaggctcgcgtgaaggcgcgtcctgccgttgcggcggcgctgaaggcagaaggcctg
agcgcgtaa

DBGET integrated database retrieval system