KEGG   Cronobacter dublinensis: AFK67_13045Help
Entry
AFK67_13045       CDS       T04061                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cdm  Cronobacter dublinensis
Pathway
cdm00550  Peptidoglycan biosynthesis
cdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFK67_13045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdm01002]
    AFK67_13045
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdm01011]
    AFK67_13045
Enzymes [BR:cdm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AFK67_13045
Peptidases and inhibitors [BR:cdm01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AFK67_13045
Peptidoglycan biosynthesis and degradation proteins [BR:cdm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AFK67_13045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase tRNA-synt_1_2
Motif
Other DBs
NCBI-ProteinID: ALB68857
UniProt: A0A0K2P8I3
LinkDB All DBs
Position
complement(2837775..2838941)
Genome map
AA seq 388 aa AA seqDB search
MKFRPMIAVSCIMLAGITAQAHAAAPVMPQPPAIMAGSYVLMDYTTGQILAANNEHQQRN
PASLTKLMTGYVVDRAIDSHRITPDDVVTVGKDAWAKDNPVFEGSSLMFLKAGDRVTVRD
LSRGLIVDSGNDACVALADYVAGGQPQFVAMMNDYVQKLGLKDTHFETVHGLDAPGQHSS
AFDLAVLSRAIIHGEPAFYHMYSEKSLTWNGITQQNRNGLLWDKTLNVDGLKTGHTSGAG
FNLIASSVDGKRRLIAVIMGADSPKGREDQARKLLHWGQQTFDTVEILQKGKKVGSERVW
YGKNEQVAVGTDRDFWLTLPKAQLASVKAKYLLDRDRLDAPLAANERVGEIELYNGDQIV
ARLPLVTLEKVKKGGVFSRFGDWLHLTL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatttagaccaatgattgccgtttcctgcatcatgttggccggtattaccgcgcag
gcgcacgccgccgcgcctgtcatgccacagccgccagccattatggcgggcagctatgtg
ttaatggattacacgaccggacaaatcctcgcggcaaataacgaacatcaacagcgtaac
ccggcgagcctgacgaaattaatgaccggctatgtggtggaccgcgccatcgacagccat
cgcattacgccggatgacgtggtgacagtcggcaaagacgcttgggcgaaagataacccg
gtgtttgaaggctcgtcactcatgttcctgaaagcgggcgatcgcgtgacggtgcgtgac
ctcagccgcgggctgattgttgactccggcaacgacgcctgcgtggcgctggcggattac
gtggcgggcggtcagccgcagttcgtcgcgatgatgaatgactacgtgcaaaagctcggg
ctcaaagatacccattttgaaaccgtccacggactcgacgcgccggggcagcacagctcc
gcgttcgatttggccgtattgtcgcgcgccattattcacggcgagccggcgttttatcat
atgtacagcgaaaagagcctgacctggaacggcatcacccagcagaaccgcaacggactg
ttgtgggataaaacgctcaacgtcgacggcctgaaaaccggccacacctcgggcgcaggc
tttaaccttatcgcctccagtgttgacggcaagcgtcgtctgatcgcggtgattatgggc
gctgacagcccgaaaggccgcgaagatcaggcgcgcaaactccttcactggggccagcag
accttcgacaccgtagagatcctccagaaaggcaaaaaagtgggcagcgagcgtgtctgg
tacggtaaaaacgagcaggtggcggtcggcaccgatcgcgacttctggctgacgctgcca
aaagcgcagctcgccagtgtgaaagccaaatatcttctggatcgcgaccgtctcgacgcg
ccgctggccgccaatgaaagggtgggtgagatagaactctacaatggcgatcagatagtc
gcgcgtctgccgctggtgacgcttgagaaagtgaaaaagggcggcgtgttctcgcgcttt
ggcgactggctgcacctgacgctgtaa

DBGET integrated database retrieval system