KEGG   Castellaniella defragrans: BN940_03336Help
Entry
BN940_03336       CDS       T03058                                 

Definition
(GenBank) Pyridoxal-5'-phosphate phosphatase
  KO
K07025  putative hydrolase of the HAD superfamily
Organism
cdn  Castellaniella defragrans
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BN940_03336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD DUF218
Motif
Other DBs
NCBI-ProteinID: CDM23142
UniProt: W8X1K6
LinkDB All DBs
Position
complement(724976..725716)
Genome map
AA seq 246 aa AA seqDB search
MHAPSPLRRRRPLGPDDPVWLFDLDNTLHDASRGIFRAIDRRMGAAVARTLDLPQDQADA
LRLRYWQRYGATAIGLARHHGVNLRQFLATCHDFDIAPLVHAETGLAARLRGLPGRRIVL
TNAPAHYARRVLDALGILQEFDGLWAIDHMMPMGLARPKPSPGLMRMVAARLGVPARRII
LVEDTERNLKSARQAGMRTVWLYHPGTPFSRQRNGRDLYVDARINRLGTLLLQARAGRMP
GSRDRA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcccccagccccctgcggcgccgtcggcccctcgggcccgacgatccggtctgg
ctgttcgacctggacaacaccctgcacgacgcctcgcgcggcatcttccgcgccatcgac
cggcgcatgggcgccgccgtggcacggacgctggacctgccccaggaccaggccgacgcc
ctgcgcctgcgctactggcagcgctacggcgccaccgccatcggcctggcgcgccaccac
ggggtgaacctgcgccagttcctggccacctgccacgatttcgacatcgccccgctggtg
cacgccgagaccggcctggccgcccggctgcgcggcctgccgggcaggcgcatcgtgctg
accaacgcccccgcccactacgcccgccgggtgctggatgcgctggggatcctgcaggaa
ttcgacggcctgtgggccatcgaccacatgatgcccatggggctggcgcggcccaagccc
tcgccgggcctgatgcgcatggtggccgcccggctgggcgtgcccgcccgccggatcatc
ctggtcgaggacaccgagcgcaacctgaaatcggcccgccaggccggcatgcgcaccgtc
tggctgtaccacccgggcacgccgttctcgcgccagcgcaacggccgcgacctgtacgtg
gatgcgcggatcaaccgcctggggaccctgctgctgcaggcccgcgccgggcgcatgccg
ggcagtcgggatcgcgcctga

DBGET integrated database retrieval system