KEGG   Castellaniella defragrans: BN940_06821Help
Entry
BN940_06821       CDS       T03058                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00020  Citrate cycle (TCA cycle)
cdn00480  Glutathione metabolism
cdn01100  Metabolic pathways
cdn01110  Biosynthesis of secondary metabolites
cdn01120  Microbial metabolism in diverse environments
cdn01130  Biosynthesis of antibiotics
cdn01200  Carbon metabolism
cdn01210  2-Oxocarboxylic acid metabolism
cdn01230  Biosynthesis of amino acids
Module
cdn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN940_06821
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN940_06821
Enzymes [BR:cdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BN940_06821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CDM23832
UniProt: W8X2X6
LinkDB All DBs
Position
1447604..1448860
Genome map
AA seq 418 aa AA seqDB search
MSYQHIKVPAGGQKITVNADFSLNIPDEPIVPYIEGDGTGQDITPVMLKVVDAAVAKAYG
GKRKIHWMEVYAGEKSTRIYGPDVWLPEETLEAVREYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVRYFKGVPSPVREPEKTDMVIFRENSEDIYAGIEFEAESDKARQLIEF
LQDKLGVKKIRFPGTSGIGVKPVSREGTERLVRKAIQYAIDNDRPSVTLVHKGNIMKFTE
GGFRDWGYALAQKEFGAQLIDGGPWCKFKNPKTGRDITVKDVIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHMGWTEAADLIISSMEKSILSKKVTYDFARLMEGATQVSCSGFGQVMIDNM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcagcacatcaaggtcccggccggcggacagaagatcacggtcaacgccgat
ttctccctgaacatccccgatgagcccatcgttccctacatcgagggcgacggcacgggc
caggacatcaccccggtgatgctgaaggtcgtggacgccgcggtcgccaaggcctacggc
ggcaagcgcaagatccactggatggaagtctacgccggcgagaaatccacccggatctac
ggcccggacgtctggctgcccgaggaaaccctggaagccgtgcgcgagtacgtcgtctcc
atcaagggcccgctgaccaccccggtgggcggcggcatccgttcgctgaacgtggccctg
cgccaggaactggacctgtacgtctgcctgcgcccggtgcgctacttcaagggcgtgccc
tcgcccgtgcgcgagccggaaaagaccgacatggtcatcttccgcgaaaactccgaggac
atctacgccggcatcgaattcgaggccgaatccgacaaggcccgccagctcatcgaattc
ctgcaggacaagctgggcgtcaagaagatccgcttccccggcacctccggcatcggcgtc
aagcccgtgtcgcgcgaaggcacggaacgcctggtgcgcaaggccatccagtacgccatc
gacaacgaccgcccgagcgtcaccctggtgcacaagggcaacatcatgaagtttaccgaa
ggcggcttccgcgactggggctacgccctggcccagaaggaattcggcgcccagctgatc
gacggcggcccgtggtgcaagttcaagaaccccaagaccggccgcgacatcacggtcaag
gacgtcatcgccgacgccttcctgcagcagatcctgctgcgcccggccgaatacgacgtc
atcgccacgctgaacctgaacggcgactacatctccgacgccctggccgcccaggtcggc
gggatcggcatcgccccgggcgccaacctgtcggattccgtggccatgtttgaagccacc
cacggcaccgcgccgaagtacgccggcaaggactacgtcaacccgggttcggagatcctg
tccgccgaaatgatgctgcgccacatgggctggaccgaggccgccgacctgatcatcagc
agcatggaaaaatccatcctgtcgaagaaggtcacctacgacttcgcccgcctgatggaa
ggcgcgacccaggtgtcgtgctccggcttcggccaggtgatgatcgacaatatgtga

DBGET integrated database retrieval system