KEGG   Castellaniella defragrans: BN940_10516Help
Entry
BN940_10516       CDS       T03058                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabA form
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00061  Fatty acid biosynthesis
cdn01100  Metabolic pathways
cdn01212  Fatty acid metabolism
Module
cdn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BN940_10516
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdn01004]
    BN940_10516
Enzymes [BR:cdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BN940_10516
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     BN940_10516
Lipid biosynthesis proteins [BR:cdn01004]
 Fatty acid synthase
  Component type
   BN940_10516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: CDM24563
UniProt: W8WXS7
LinkDB All DBs
Position
complement(2272882..2273394)
Genome map
AA seq 170 aa AA seqDB search
MQKNSYSYDELLACGRGELFGPGNAQLPLPPMLMLDRITHIDDKGGAHDKGQIVAELDIR
PDLWFFDCHFKGDPVMPGCLGLDAMWQLVGFFLGCCGGQGRGRALGVGEVKFTGQVLPTG
KLVRYTIDMKRVMMRKLVMGIADARMEVDGHEIYAAHDLRVGLFTRTDNF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaacagctatagctacgacgaactgctggcgtgcgggcgcggggaactcttc
ggtcccggcaatgcccagctgccgctgccgcccatgttgatgctcgaccggatcacgcac
atcgatgacaagggcggcgcgcacgacaagggtcagatcgtggccgagctcgacatccgc
cccgacctgtggttcttcgactgccatttcaagggcgatccggtcatgccgggctgcctc
gggctggatgccatgtggcagctggtgggctttttcctgggctgctgcggcggccagggc
cggggccgcgccctgggcgtgggcgaggtcaagttcaccggccaggtcctgcccaccggc
aagctggtccgctataccatcgacatgaagcgcgtcatgatgcgcaagctggtgatgggc
atcgccgacgcccgcatggaggtcgacggccacgagatctacgcggcacacgacctgcgc
gtgggcctgttcacccgcacggacaatttctag

DBGET integrated database retrieval system