KEGG   Castellaniella defragrans: BN940_11951Help
Entry
BN940_11951       CDS       T03058                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00564  Glycerophospholipid metabolism
cdn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BN940_11951
Enzymes [BR:cdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BN940_11951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 HI0933_like Thi4 Pyr_redox_3 Pyr_redox_2 Lycopene_cycl GIDA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: CDM24848
UniProt: W8WYL2
LinkDB All DBs
Position
complement(2579763..2581448)
Genome map
AA seq 561 aa AA seqDB search
MFQTAVLPPVTTDRDRLLHDLEALSEVDLIVIGGGASGLGVALDARLRGLSVLLLESHDF
AGGTSSRATKLVHGGVRYLAQGNIGLVREALHERRALLNNAPHLAQPLAFVMPAYRPWEV
PFYGLGLKIYDALAGSASLGRTEWLGRAGTAARLPGVNAAGLFGGVQYWDGQFDDARLAL
ALARTAAAQGALVLNYCPVVDVLHENGRVGGVRWRDARDAGGRREGTVRARCVINATGVW
VDELRRLDDAARGQDTAPMVAPSQGVHLVVDRSFMPADEALLVPRTRDGRVLFAVPWLGH
LILGTTDTPRDAVAREPRALPEEIAFILNESAHVLARAPRAGDVLSVWVGLRPLVRPAHE
DEAGHGAVPADCAMPDESEPLASGKVRGGTKTISREHTVRVSPSGLVTVTGGKWTTYRSM
AEDVLRHCQGAGLLPALPPCRTAHFPLLGAPPPGAPATRLTHPPGLHAYGTEAADVQALP
GAGNELGLGLTEAMVRHAARREYARTVEDVLARRHRMLFLHADRAIQVAPAVARILAEEI
GSDGDLGAFLALAEQYRHVPA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgttccagactgctgtcctgccgcccgtcacgacggatcgggatcgattgctgcatgac
ctcgaggcgctgtccgaggtcgatctgatcgtcatcggcgggggcgccagcggcctgggc
gtcgccctggacgcccggctgcggggcctgtcggtcctgctgctggagtcccacgatttc
gccggcggcacctcatcgcgcgcgaccaagctcgtgcacggcggggtccgctatctggcc
cagggcaacatcggcctggtgcgcgaagccctgcacgaacgccgggcgctgctgaacaac
gcgccgcacctggcccagcccctggccttcgtcatgcccgcctaccggccctgggaagtg
ccgttctacggcctgggcctgaagatctacgatgccctggccggctccgccagcctgggc
cgcaccgaatggctggggcgcgccggcacggccgcccggctgccgggcgtcaacgcggcc
ggcctgttcggcggcgtccagtactgggacggccagttcgacgacgcccggctggccctg
gcgctggcccgcacggccgccgcccagggcgccctggtgctgaattactgccccgtcgtc
gacgtgctgcacgaaaacggccgcgtcggcggcgtgcgctggcgcgatgcccgggatgcc
ggcgggcgccgcgagggcacggtccgcgcccgctgcgtcatcaacgccaccggcgtctgg
gtggacgaactgcgccgcctggacgatgccgcccgggggcaggacaccgcccccatggtg
gcgcccagccagggagtgcacctggtagtggaccggtccttcatgccggccgacgaggcc
ctgctggtgccgcgcacccgcgacggccgggtgctgttcgccgtgccctggctggggcac
ctgatcctgggaaccaccgatacgccgcgcgacgccgtcgcccgcgagccgcgggcgctg
cccgaggaaatcgccttcatcctgaacgaatccgcccacgtgctggcgcgcgcgccccgg
gccggggatgtgctcagcgtctgggtcgggctgcgccccctggtgcggccggcgcacgag
gatgaagctggacatggagcagtccctgcggactgcgccatgcctgacgaatccgagccg
cttgcaagcggcaaggtgcggggcggcaccaagaccatcagtcgcgagcacaccgtgcgc
gtcagcccctccggactggtgaccgtgaccggcggcaagtggaccacctatcgttccatg
gccgaggacgtcctgcgccattgccagggcgcggggctgctgccggccctgccgccctgc
cgcacggcgcatttcccgctgctgggcgcgccgccgcccggcgcgcccgccacgcgcctg
acgcacccgccggggctgcacgcctacggcaccgaggccgccgacgtgcaggcgctgccg
ggcgcgggcaacgagctgggcctgggcctgaccgaggccatggtgcgccacgccgcgcgc
cgcgaatacgcccgcaccgtcgaggacgtgctggcccggcgccaccggatgctgtttctg
catgcggaccgggcgatccaggtggcgcccgccgtcgcccgcatcctggccgaggaaatc
ggctcggacggcgatctgggcgccttcctggccctggccgaacagtaccgccacgtgccg
gcctga

DBGET integrated database retrieval system