KEGG   Castellaniella defragrans: BN940_17016Help
Entry
BN940_17016       CDS       T03058                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cdn  Castellaniella defragrans
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN940_17016
Enzymes [BR:cdn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BN940_17016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin FAD_oxidored Thi4 FAD_binding_3 HI0933_like FAD_binding_2 DAO K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CDM25836
UniProt: W8X647
LinkDB All DBs
Position
complement(3689332..3690903)
Genome map
AA seq 523 aa AA seqDB search
MLDANLKGQLGTYLERVTLPVELRASLDDGAQSQELRAFLEDIASLSDKITVTDDAPGAR
VPSFAIARAGTDVAVRFAGIPLGHEFTSLVLALLQVGGHPPKLDEAVAEQVRKLPGDYTF
ETYFSLSCQNCPDVVQALNAMSVLNPRIRHVAIDGALFQDEVQQREILSVPAVFLNGELF
HQGRAGVEELLAKLDAGDTSAKVDALNARDEFDVLVVGGGPAGAAAAVYAARKGICTGVV
AERFGGQVLDTMAIENYISVLETEGPKFGVALEQHVKAYEVDIMNLQRASRLVPGKSIQV
ELASGAVLKAKTVILSTGARWRQINVPGENEYRNRGVAYCPHCDGPLFKGKRVAVIGGGN
SGVEAAIDLAGIVGHVTLIEFGDALRADDVLQRKLRSLSNVTVITSAQTTEIHGDGKRVT
GLSYTDRASGAAHRVELEGVFIQIGLVPNTEWLKGTVELSKHGEIVVDARGQTSVPGVFA
AGDATTVPYKQIIIAAGEGAKAALAAFDHLIRSSVAAEEKAVA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgcaaacctcaaagggcaattgggaacctacctcgagcgggtgacgctgccc
gtcgaattgcgcgcgtcgctggacgatggcgcccagtcgcaggaactgcgggcctttctg
gaagacatcgccagcctgtccgacaagatcaccgtgacggacgacgcccccggggcgcgc
gtgccgtcgttcgcaatcgcccgcgccggcaccgacgtggccgtgcgcttcgccggcatc
ccgctgggccatgaattcacctcgctggtgctggccctgctgcaggtcggcggccatccg
cccaagctggacgaggccgtggccgagcaggtccgcaagctgccgggcgactatacgttt
gaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaacgcg
atgtcggtcctcaacccgcgcatccgccacgtggcgatcgacggcgccctgttccaggac
gaagtccagcagcgcgagatcctgtccgtgcccgcggtgttcctgaacggcgagctgttc
caccagggccgcgccggcgtcgaggaactgctggccaagctggacgccggcgacacgagc
gccaaggtcgatgccctgaacgcccgcgacgagttcgacgtgctggtggtcggcggcggc
cccgcgggcgccgcggcggccgtgtacgcggcgcgcaagggcatctgcaccggcgtggtg
gccgaacgcttcggcggccaggtgctcgacaccatggcgatcgagaactacatctccgtg
ctcgagaccgaagggcccaagttcggcgtcgcgctggagcagcacgtcaaggcctacgaa
gtggacatcatgaacctgcagcgggccagccgcctggtgccgggcaagtcgatccaggtc
gaactggccagcggcgccgtgctgaaggccaagaccgtcatcctgtccactggcgcgcgc
tggcgccagatcaacgtgcccggggaaaacgaataccgcaaccgcggcgtggcctactgc
ccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggcggcggcaac
tccggcgtcgaggcggcgatcgacctggccggcatcgtgggccacgtcacgctgatcgag
ttcggcgacgccctgcgggccgacgacgtgctgcagcgcaagctgcgcagcctgtccaac
gtgaccgtcatcacctcggcccagaccaccgagatccacggcgacggcaagcgcgtgacc
ggcctgagctacaccgaccgcgccagcggcgccgcgcatcgcgtcgagctggaaggcgtg
ttcatccagatcggcctggtgcccaacaccgaatggctcaagggcacggtcgagctcagc
aagcacggcgagatcgtggtcgatgcccgcggccagacctcggtgcccggcgtgttcgcc
gcgggcgacgcgacgacggtgccgtacaagcagatcatcatcgccgccggcgaaggcgcc
aaggccgccctggccgccttcgaccacctgatccgcagctcggtcgcggccgaggaaaag
gccgtcgcctga

DBGET integrated database retrieval system