KEGG   Castellaniella defragrans: BN940_17931Help
Entry
BN940_17931       CDS       T03058                                 

Definition
(GenBank) Penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00550  Peptidoglycan biosynthesis
cdn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN940_17931
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN940_17931
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdn01011]
    BN940_17931
Enzymes [BR:cdn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN940_17931
Peptidoglycan biosynthesis and degradation proteins [BR:cdn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BN940_17931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Lsr2
Motif
Other DBs
NCBI-ProteinID: CDM26017
UniProt: W8X5X7
LinkDB All DBs
Position
complement(3858375..3861626)
Genome map
AA seq 1083 aa AA seqDB search
MFEFRKTGHRQRQTVLLRAWVAGLFALVCLLLLAGRLWYLQVVRYDTLSARAEQNRITIV
PVPPRRGQIADRNGAVLAQNLRDYTLTVTRAQIRGDINDVLDRLGELVYLSEGDRRKFMR
LYQQSGRYAPVLLRNNLNDIEASWFAVHAYRFPGVSLEARWVRSYPMHESAAHVLGFVGR
ISEEDQQELDESGQLGNYRGTLVIGKKGVEKTWEKALHGRTGVEELEVTAGGRPVRELSR
TDPVPGANLELSLDIGLQQLAEAQFEGRRGALVAIQPHTGEILAFVSSPSFDPNLFVDGI
DVENWRKLNESPDHPLINRPLYGTYPIGSTYKPFVGLAALEMGLRSARELIPDPGYFELA
GQKFRNAGGAAYGPTDMHRAIVVSSDTYFFSLGAQMDVDALHDFTGRFGFGQITGIDLDG
ERRGVLPSRAWKRKTYKKPEQQHWYRGETVSVTVGQGYNAFTLLQLAQATSVLANDGVYM
KPHLVRRIIDPLTGRFSYPVVGPQYTIDLKPDNLRVIREAMVDVVRKGTARRAFEGAAYQ
AAGKTGTAQVYSLRGAKYKAQAVDERLRDHALFMAYAPVEDPQIAVALIVENGGWGASVA
APIARTVFDYWLDPARVAQRGERLRAEQAARAAQAGPLPAAAPGRPDAQPAPTTRRRPSP
RPCPTRPRRPRTAPRRKTHETDRAGGAPHVRRAGLADARPAGRHGPGRHGHHAFGGGQHR
LALRRPAAQLHAGVRGHVGRRADAPGLDHALGAAVLCARGGAAGGGHAVRRDQQGRDPLA
EPGLRAHPALGDDEDRRAADAGLVFPAPVGQPLPHPGLPRGRRAAAGAGGAHHRAAGPGH
GAAGAGLGLLRHLFRRPVVQAADPGGAGGHAGARDAGGLRGPDLPAGGGLGGAARLPEIP
RLRAAQSGLGPAGQGLPHHPVHDRGGLGRPLWQGLHAGHPDAPGLHPRADHGLHLRRVRR
GIRPVRRGGPAHPVHAAGAARPDHHRAGAHAVRAAAGRRHVHDDVRLRLREHRHGDRSAA
GGGGAAALHELRRHGADDAGRGLRPADEHRRAPAAPGSLSGQRGSGVSAYSPASSRATGA
GMP
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagttccgcaagaccggccaccgccagcggcagacggtgctgctgcgcgcgtgg
gtcgcggggctgttcgccctggtctgcctgctgctgctggccgggcgcctgtggtacctg
caggtcgtgcgctacgacaccctgtcggcgcgcgccgagcagaaccgcatcaccatcgtg
cccgtgccgccccggcgcgggcagatcgccgaccgcaacggcgcggtgctcgcgcagaac
ctgcgcgactacacgctgacggtgacgcgcgcccagatccggggcgacatcaacgacgtg
ctcgaccgcctcggcgagctggtctacctgagcgagggcgaccggcgcaagttcatgcgc
ctgtaccagcagagcggccgctacgcgccggtcctgctgcgcaacaacctcaacgacatc
gaggcgtcctggttcgccgtccacgcctaccgctttcccggcgtcagcctggaggcgcgc
tgggtgcgctcctaccctatgcacgaatcggccgcgcacgtgctgggcttcgtcggccgc
atctccgaggaggaccagcaggagctggatgaatccggccagctcggcaactaccggggc
acgctggtcatcggcaagaagggcgtcgagaagacctgggaaaaggccctgcacggccgc
accggggtcgaggaactcgaagtcacggcgggcgggcggccggtgcgcgaactgagccgc
accgacccggtgcccggcgccaacctggaactgtccctggacatcggcctgcagcagctg
gccgaggcccagttcgagggccggcgcggcgcgctggtcgccatccagccgcatacgggc
gagatcctggccttcgtgtcctcgccgtccttcgacccgaacctgttcgtggacggcatc
gacgtggagaactggcgcaagctgaacgaatcgcccgaccatccgctcatcaaccggccg
ctgtacggcacctatcccatcggctcgacctacaagcccttcgtcggcctggccgccctg
gaaatgggcctgcgctcggcgcgggaactgatccccgaccccggctacttcgagctggcc
gggcagaagttccgcaacgccggcggcgcggcctacggcccgaccgacatgcaccgggcc
atcgtcgtgtcctccgacacctacttcttctcgctgggcgcgcagatggacgtggacgcc
ctgcacgacttcaccgggcggttcggcttcggccagatcaccggcatcgacctggacggc
gagcgccgcggcgtgctgccttcgcgcgcctggaagcgcaagacctacaagaagcccgag
cagcagcactggtaccgcggcgagaccgtgtccgtcaccgtggggcagggctacaacgcc
ttcaccctgctgcagctggcgcaggcgacctcggtgctggccaacgacggcgtctacatg
aagccgcacctggtgcgccggatcatcgatccgctcaccgggcgcttcagctatcccgtg
gtcgggccgcaatacaccatcgacctgaaaccggacaacctgcgcgtgatccgcgaggcc
atggtggacgtggtgcgcaagggcacggcgcggcgcgccttcgagggcgcggcctaccag
gcggccggcaagaccggcacggcccaggtctacagcctgcgcggcgccaagtacaaggcg
caggcggtcgacgagcgcctgcgcgaccacgcgctgttcatggcctacgcgccggtcgag
gacccccagatcgcggtggccctgatcgtggaaaacggcggctggggcgcctcggtggcc
gcgccgatcgcccggacggtgttcgattactggctggatccggcccgcgtggcgcagcgc
ggcgaacgcctgcgggcggaacaggccgcgcgggccgcccaggcgggcccgctgccggcg
gccgcgccgggacggcccgacgcgcagccggccccgacgacgaggaggcgcccgagcccg
cgcccctgcccgacgaggcctcggcgcccgaggacggcgcccaggaggaaaacccatgaa
actgatcgtgctggcggtgcgccgcatgttcgccgtgctggactggccgatgctcgccct
gctggccgtcatgggcctggtcggcatggccaccatgcattcggcggtgggcaacaccga
ctggcgcttcgccgaccagctgcgcaacttcatgctggcgttcgcggccatgtgggccgt
cgcgctgatgcgcccggcctggatcatgcgctcggcgccgctgttctatgcgctcggggt
ggggctgctggtggcggtcatgctgttcggcgagaccagcaagggcgcgacccgctggct
gaacctgggcttcgtgcgcatccagccctcggagatgatgaagatcgccgtgccgctgat
gctggcctggtatttccagcgccagtcggccaaccgcttccgcatcctggacttcctcgt
ggccggcgtgctgctgctggtgccggcggggctcatcatcgagcagccggacctgggcac
ggcgctgctggtgctggcctcgggcttctgcgtcatctatttcgccggcctgtcgttcaa
gctgctgatcccggcggtgctggcggtcacgctggcgctcgggacgctggtggcctacga
ggaccagatctgccagccggaggtggactgggtggtgctgcacgactaccagaaataccg
cgtctgcgtgctgctcaatccgggctcggacccgctgggcaagggcttccacaccatcca
gtccatgatcgcggtgggctcgggcggcctctatggcaagggctacatgcagggcaccca
gacgcacctggacttcatccccgagcggaccacggacttcatcttcgccgtgttcgccga
ggaattcggcctgtacggcggggtggccctgctcatcctgtacacgctgctggtgctgcg
cggcctgaccatcaccgtgcgggcgcccacgcagttcgggcggctgctggccggcgccat
gtccatgatgatgttcgtctacgtcttcgtgaacatcggcatggtgaccggagtgctgcc
ggtggtgggggtgccgctgcccttcatgagctacggcggcacggcgctgatgacgctggg
cgtggcctgcggcctgctgatgagcatcggcgcgcaccagccgcgcccggatccctgagc
ggtcagcgcggcagcggcgtgtccgcgtacagcccggccagcagccgcgcgaccggcgcc
ggcatgccgtag

DBGET integrated database retrieval system