KEGG   Castellaniella defragrans: BN940_17941Help
Entry
BN940_17941       CDS       T03058                                 

Definition
(GenBank) Rod shape-determining protein MreC
  KO
K03570  rod shape-determining protein MreC
Organism
cdn  Castellaniella defragrans
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdn03036]
    BN940_17941
Chromosome and associated proteins [BR:cdn03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BN940_17941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreC bZIP_1 YabA TSC22 YajC
Motif
Other DBs
NCBI-ProteinID: CDM26019
UniProt: W8X233
LinkDB All DBs
Position
complement(3862186..3863070)
Genome map
AA seq 294 aa AA seqDB search
MHEPGTLRLFKRGPSIEVRLVLLLALCLGMVVTDAHWSVLGPVRSGLSMVLYPFQRIALA
PRDALEYFDSWSQAAALARDEQEALRRQRIEMAQLSTHAAQLATENEQLRRLLNVSESIA
QQSVAVEVFYVPSNAFSHRLIFNKGSRAGIAPGMPVIDEGGVVGQIVRVTPFTSEAALLI
DDQVSIPVQVLRNGLRLIAFGGNEVGKLEVRYLSAGVDVRVGDVLVTSGIGGLFPSGLSV
GRIERVERDPGTGFAMAIAEPLSHPERYRHFLVLRVDVDDVPRPEEIEHALEQQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaacctggaaccctgagactcttcaagcgcggtcccagcatcgaagtccggctg
gtcctgctgctggccctgtgtctcgggatggtcgtgaccgacgcgcactggtccgtgctg
gggccggtgcgcagcggcctgtccatggtcctctatcccttccagcgcatcgccctggcg
ccgcgcgacgcgctggaatatttcgacagctggtcgcaggcggccgcgctggcgcgcgac
gaacaggaagccctgcgccgccagcgcatcgaaatggcccagctctcgacccacgcggcc
cagctggccaccgaaaacgaacagctgcgccgcctgctcaacgtgtccgaatccatcgcc
cagcagtccgtggcggtcgaggtcttctacgtgccctccaatgccttcagccatcgactg
atcttcaacaagggctcgcgcgccggcatcgccccgggcatgccggtgatcgacgagggc
ggggtcgtgggccagatcgtgcgcgtcacgcccttcacctccgaggccgccctgctgatc
gacgaccaggtgtccatccccgtccaggtgctgcgcaacgggctgcggctgatcgcgttc
ggcggcaacgaggtcggcaagctcgaagtccgctacctgtcggccggcgtggacgtgcgc
gtgggcgacgtgctggtgaccagcggcatcggcggcctgttcccctcgggcctgtcggtc
ggccgcatcgaaagggtcgagcgcgatccgggcaccggcttcgccatggcgatcgccgag
ccgctgtcgcatcccgagcgctaccgccatttcctggtcctgcgcgtggacgtggacgac
gtgccccgcccggaggagatcgagcatgccctcgagcagcaatag

DBGET integrated database retrieval system