KEGG   Castellaniella defragrans: BN940_17956Help
Entry
BN940_17956       CDS       T03058                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A / Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00970  Aminoacyl-tRNA biosynthesis
cdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN940_17956
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cdn03029]
    BN940_17956
Enzymes [BR:cdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN940_17956
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN940_17956
Mitochondrial biogenesis [BR:cdn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN940_17956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CDM26022
UniProt: W8X5X9
LinkDB All DBs
Position
3864705..3866228
Genome map
AA seq 507 aa AA seqDB search
MNQLAEFHSIQALGAALRARRVSAFELAADALRAARAYADPNVFLHIDDDLTLAQARAAD
QALAAGAAGPLTGIPVAHKDLFVTRGWRTTAASRMLAGYVSPFDAAVVERWREAGAVSLG
KLSCDEFAMGSGNENSAFGPVRNPWDPERVPGGSSGGSAAAVAAGLVLGATGTDTGGSVR
QPAALCGVSGIKPTYGTVSRYGIIAYASSLDQAGPLARSARDLVPLLDAMSGFDPRDSTS
LESCDGAPNAAGRVQAAFDAAQAGFQAGGERPLAGLRIGVPREFLNEGLSAEVGAAVEAA
LRVFESLGAVRVDVSLPRTRLSIPAYYVIAPAEASSNLSRYDGVRYGHRAAVYADLADMT
SRSRSEGFGDEVRRRILVGAYVLSHGYYDAYYLQAQRVRRMIADDFRRVLTEDCDVIMGP
VTPAVARRIGDNRQDPIADWLGDIYTLGVSLAGLPGMSIPCGFGGESGRLPIGLQLIGRY
FDEGRLLALADRYQQATDWHQRTPGHA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcttgcagaattccacagcatccaggcgctgggcgcggccctgcgcgcccgg
cgcgtcagcgcctttgagctggccgccgacgccctgcgcgcggcgcgcgcctacgccgac
cctaacgtcttcctgcacatcgacgacgacctgaccctggcgcaggcgcgcgccgccgac
caggcgctggccgcgggcgccgccgggccgctcaccggcatccccgtggcccacaaggac
ctgttcgtgacgcgcggctggcgcaccaccgccgccagccggatgctggccggctacgtc
agccccttcgacgccgccgtggtcgagcgctggcgcgaggccggcgccgtctcgctgggc
aagctcagctgcgacgaattcgccatgggctcgggcaacgagaattccgccttcggcccg
gtgcgcaatccctgggacccggaacgcgtcccgggcggctcgtccggcggctccgccgcc
gccgtggccgccggcctggtgctgggcgccaccggcacggacaccggcggctcggtgcgc
cagcccgccgccctgtgcggcgtcagcggcatcaagcccacctacggcacggtctcgcgc
tacggcatcatcgcctacgcctccagcctggaccaggccggccccctggcgcgcagcgcc
cgcgacctggtgccgctgctggacgccatgagcggcttcgacccgcgcgactccaccagc
ctggaatcctgcgacggcgcgcccaacgccgccggccgcgtccaggccgcgttcgatgcc
gcccaggccggcttccaggcgggcggcgagcgcccgctggcggggctgcgcatcggcgtg
ccgcgcgagttcctcaacgaaggcctgtccgccgaggtcggcgccgccgtcgaagcggcc
ctgcgggtcttcgaatccctgggcgcagtgcgcgtggacgtgtccctgccgcgcacacgc
ctgtcgatcccggcctactacgtgatcgccccggccgaggcctccagcaacctgtcgcgc
tacgacggggtgcgctacggccaccgcgcagccgtttacgccgacctggccgacatgacc
agccggtcccgctccgagggcttcggcgacgaggtccgccgccgcatcctggtgggcgcc
tacgtgctgtcgcacggctactacgacgcctactacctgcaggcccagcgcgtgcggcgc
atgatcgccgacgacttccgccgggtcctgaccgaggactgcgacgtgatcatgggcccg
gtcacccccgccgtggcgcgccgcatcggcgacaaccgccaggacccgatcgccgactgg
ctgggcgacatctacacgctgggcgtcagcctggcgggcctgccgggcatgtccatcccc
tgcggcttcggcggcgaatcgggccgcctgcccatcgggctgcagctcatcggccgctat
ttcgacgaaggccgcctgctggccctggccgaccgctaccagcaggccaccgactggcac
caacgcaccccgggacacgcataa

DBGET integrated database retrieval system