KEGG   Castellaniella defragrans: BN940_17961Help
Entry
BN940_17961       CDS       T03058                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B / Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cdn  Castellaniella defragrans
Pathway
cdn00970  Aminoacyl-tRNA biosynthesis
cdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN940_17961
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cdn03029]
    BN940_17961
Enzymes [BR:cdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN940_17961
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN940_17961
Mitochondrial biogenesis [BR:cdn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN940_17961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: CDM26023
UniProt: W8X1Q4
LinkDB All DBs
Position
3866228..3867685
Genome map
AA seq 485 aa AA seqDB search
MDWEIVIGLETHAQLSTRSKIFSRSSTRFGAEPNTQANAVDMALPGSLPAMNRGAVERAI
QFGLAVGARVAERSVFARKNYFYPDLPKNYQISQFELPIVVGGQLSFFVGEQEHTVRLTR
AHLEEDAGKSLHEHFTGPHGESSSGIDLNRAGTPLLEIVSEPEMRSAAEAVAYARTLHGL
VVWLGICDGNMQEGSFRCDANVSVRPRGQAEFGTRCEIKNLNSFRFLERAIQYEARRQIE
LIEDGGRVVQETRLYDADRDETRSMRTKEDSDDYRYFPDPDLPPLVVAPDWIEQVRQAMP
ELPAAKRARFEADLGLSAYDAAQLTLHRATADYFEAAAAALPAGQAKQAANWILGELSAA
LNRDGLDIGASPVSPRRLAALIARVLDGTISTKIARDVFAAMWTGESGGDPDAIIESRGL
RQISDTGAIEAMIDTVLAANPAIVEEYRAGKQKAFNSLVGQVMKAAKGKANPQQVNEVLK
RKLES
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggattgggaaatcgtcatcgggctggaaacccacgcccagctctccacgcggtcgaaa
atcttttcccgcagcagcacgcgcttcggcgccgagcccaacacccaggccaacgccgtg
gacatggccctgcccggctcgctgccggccatgaaccgcggcgcggtggaacgcgcgatc
cagttcggcctggccgtgggcgcccgggtggccgagcgctcggtgttcgcgcgcaagaac
tatttctaccccgacctgccgaagaactaccagatcagccagttcgagctgccgatcgtg
gtgggcgggcagctgtccttcttcgtgggcgagcaggaacacacggtgcgcctgacccgc
gcccacctggaagaggacgcgggcaagtcgctgcacgagcatttcaccgggccgcacggg
gaatcgtccagcggcatcgacctgaaccgcgccggcacgccgctgctggaaatcgtgtct
gaacccgagatgcgctcggccgccgaggcggtggcctatgcgcgcacgctgcacgggctg
gtagtgtggctgggcatctgcgacggcaacatgcaggaaggctctttccgctgcgacgcc
aacgtgtcggtgcgcccgcgcggccaggccgaattcggcacgcgctgcgagatcaagaac
ctgaattccttccgtttcctggaacgcgcgatccagtacgaagcgcgccgccagatcgag
ctgatcgaggacggcggcagggtggtgcaggaaacgcgcctgtacgacgccgaccgcgac
gaaacccgcagcatgcgcacgaaggaagattccgacgattaccgctatttccccgatccg
gatctgccgccgctggtggtggcgccggactggatcgagcaggtgcgccaggcgatgccg
gagctgccggcggccaagcgcgcgcgcttcgaggccgacctgggcctgtcggcctacgac
gcggcccagctgacgctgcaccgcgcgacggcggactatttcgaggccgcggcggccgcc
ctgcccgccggccaggcgaagcaggccgccaactggatcctgggcgagctgtccgccgcg
ctgaaccgcgacggcctggacatcggcgcgtcgccggtgtccccgcggcgcctggcggcg
ctgatcgcgcgggtgctggacgggacgatctcgacgaagatcgcgcgcgacgtgttcgcg
gcgatgtggacgggcgagtcgggcggcgatccggacgcgatcatcgagtcgcgcgggctg
cgccagatcagcgacacgggggcgatcgaggcgatgatcgacacggtgctggcggccaat
ccggcgatcgtggaggaataccgggcgggcaagcagaaggcattcaattcgctggtcggc
caggtgatgaaggcggccaagggcaaggcgaatccgcagcaggtgaacgaggttctgaag
cggaagctggagtcttga

DBGET integrated database retrieval system